Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
hPPAR; MGC2237; MGC2452; NR1C1; Nuclear receptor subfamily 1 group C member 1; OTTHUMP00000197740; OTTHUMP00000197741; Peroxisome proliferative activated receptor alpha; Peroxisome proliferator activated receptor alpha; Peroxisome proliferator-activated receptor alpha; PPAR; PPAR-alpha; ppara; PPARA_HUMAN; PPARalpha
Species
Homo sapiens (Human)
Expression Region
1-468aa
Target Protein Sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human PPARA was expressed with the amino acid range of 1-468. The expected molecular weight for the PPARA protein is calculated to be 56.2 kDa. This protein is generated in a baculovirus-based system. The N-terminal 10xHis tag and C-terminal Myc tag was fused into the coding gene segment of PPARA, making it easier to detect and purify the PPARA recombinant protein in the later stages of expression and purification.
PPARA (Peroxisome proliferator-activated receptor alpha) is a nuclear receptor playing a crucial role in energy and lipid metabolism. Research primarily focuses on two major areas. Firstly, the role of PPARA in lipid metabolism regulation is widely studied. Researchers delve into the regulatory mechanisms of PPARA in fatty acid oxidation, activation of brown adipose tissue, cholesterol metabolism, providing new insights into the treatment of metabolic diseases like diabetes and hyperlipidemia. Secondly, the physiological functions of PPARA in tissues such as the liver and heart have attracted considerable attention. Researchers are attentive to PPARA's regulatory role in liver lipid metabolism, cardiac protection, and its involvement in metabolism-related inflammatory responses.
