Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein(TNFSF9),partial

Code CSB-RP080474h
Product Type Recombinant Protein
Size US$1726
Uniprot No. P41273
Relevance Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 4-1BB ligand receptorCDw137T-cell antigen 4-1BB homologT-cell antigen ILA; CD137
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Research Area Immunology
Source E.coli
Gene Names TNFSF9
Expression Region 52-254aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 25.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Tumor necrosis factor family
Tissue Specificity Expressed in brain, placenta, lung, skeletal muscle and kidney.
Database Links

HGNC: 11939

OMIM: 606182

KEGG: hsa:8744

STRING: 9606.ENSP00000245817

UniGene: Hs.1524

Related Products

TNFSF9 Antibodies

TNFSF9 Antibodies for Homo sapiens (Human)

TNFSF9 Proteins

TNFSF9 Proteins for Homo sapiens (Human)

TNFSF9 ELISA Kit

TNFSF9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.