Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 μg/mL can bind TNFRSF9(CSB-MP023984HU1), the EC50 is 2.671-3.702 ng/mL.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
71-254aa
Target Protein Sequence
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Tag Info
N-terminal hFc-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human TNFSF9 protein is an active protein generated in mammalian cells. Its expression region encodes the Arg71-Glu254 of human TNFSF9. It is tagged a human Ig1 Fc-Myc at the N-terminus. The purity of this TNFSF9 protein is greater than 90% measured by SDS-PAGE. It contains less than 1.0 EU endotoxin per ug protein determined by the LAL method. Its biological activity was assayed by binding toTNFRSF9 in a functional ELISA, and the EC50 is 2.671-3.702 ng/mL.
TNFSF9, also called 4-1BBL, is the natural ligand for TNFRSF9 (4-1BB) and is mainly expressed on activated antigen-presenting cells, including macrophages, monocytes, dendritic cells, B cells, and activated T cells. TNFSF9 is also detected on the surface of some cancer cells. TNFSF9 interacting with TNFRSF9 recruits TRAFs, especially TRAF2, activating the NF-κB pathway and MAPK pathway involving T cell activation, proliferation, differentiation, and apoptosis. TNFSF9/TNFRSF9 signaling has been found to mediate anti-tumor immune responses in immune cells such as T cells, NK cells, and APC, which suggests its potential to be a new antitumor biotherapy.