Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

In Stock
Code CSB-MP013227HU1
Abbreviation Recombinant Human LTBR protein, partial (Active)
MSDS
Size $90
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    ①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU) , the EC50 is 0.6450-0.8200 ng/mL. Biological Activity Assay
  • Activity
    ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 4.399-5.172 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU) , the EC50 is 0.6450-0.8200 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 4.399-5.172 ng/ml.
Target Names
Uniprot No.
Alternative Names
CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3); Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 RP; TNFR2RP; TNFR3; TNFRII; TNFRRP; TNFRSF 3; TNFRSF3; TNR3_HUMAN; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2 related protein; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor superfamily member 3 precursor; Tumor necrosis factor receptor type III
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-227aa
Target Protein Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
Mol. Weight
23.1kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human LTBR is an active protein expressed in mammalian cells and consists of the amino acid sequence from positions 31 to 227 of the human LTBR. It is tagged with a C-terminal 10xHis tag, facilitating purification and detection. The endotoxin level of this recombinant LTBR protein is less than 1.0 EU/μg, as determined by the LAL method, ensuring its suitability for various biological applications. LTBR's activity has been assessed through functional ELISA assays. The recombinant LTBR protein, immobilized at a concentration of 2 μg/mL, binds to the anti-LTBR recombinant antibody (CSB-RA013227MA1HU) and human TNFSF14 (CSB-MP023991HUj7-B), with an EC50 of 0.6450 to 0.8200 ng/mL and 4.399 and 5.172 ng/mL, respectively.

The human LTBR protein, also known as TNFR3, is a member of the TNF receptor superfamily and plays a critical role in mediating numerous cellular functions, including survival, proliferation, and apoptosis. TNFR3 is activated by ligands such as Oncostatin M (OSM), which is part of the IL-6 family of cytokines and has been shown to influence immune responses and signaling pathways linked to inflammation and cancer progression [1]. TNFR3 engages in canonical and non-canonical signaling pathways, allowing for diverse effects, such as modulating immune cell responses and contributing to cell survival mechanisms [2].

Evidence indicates that TNFR3 signaling is intricately connected with regulating NF-κB pathways, which are crucial for immune responses and inflammatory processes. Activation of TNFR3 can lead to the activation of NF-κB family members, including RelA and RelB, facilitating transcriptional responses that shape the behavior of various cell types within the immune system [3]. Such interactions underscore TNFR3's pivotal role in maintaining immune homeostasis and responding to pathological challenges.

Dysregulation of TNFR3 signaling has been implicated in various diseases, including cancers and autoimmune disorders, highlighting its potential as a therapeutic target. Studies have shown that aberrant TNFR3 signaling can promote tumor survival and contribute to inflammation within the tumor microenvironment [4].

References:
[1] T. Toyama, S. Xu, R. et al. The nuclear protein hoxb13 enhances methylmercury toxicity by inducing oncostatin m and promoting its binding to tnfr3 in cultured cells. Cells, vol. 9, no. 1, p. 45, 2019. https://doi.org/10.3390/cells9010045
[2] A. Jung, G. Kim, et al. Hmgb1/tnfr1/nf-κb axis in prostate cancer: clinical and biological correlation., 2020. https://doi.org/10.21203/rs.3.rs-40868/v1
[3] M. Jamshidi, R. Fagerholm, et al. Snp-snp interaction analysis of nf-κb signaling pathway on breast cancer survival. Oncotarget, vol. 6, no. 35, p. 37979-37994, 2015. https://doi.org/10.18632/oncotarget.4991
[4] J. Almaden, R. Tsui, et al. A pathway switch directs baff signaling to distinct nfκb transcription factors in maturing and proliferating b cells. Cell Reports, vol. 9, no. 6, p. 2098-2111, 2014. https://doi.org/10.1016/j.celrep.2014.11.024

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Gene References into Functions
  1. the lymphotoxin beta receptor (LTbetaR) to elicit the fast release of NF-kappaB inducing kinase (NIK) from the receptor complex leading to non-canonical NF-kappaB signaling. PMID: 29329668
  2. these results suggest that the LTBR rs12354 polymorphism might be associated with the spontaneous resolution of hepatitis B virus infection PMID: 28575727
  3. LTBR and BCLAF1 showed higher DNA methylation percentages in the marsupialized OKCs, but this difference did not affect gene expression (P > .05). PMID: 28864293
  4. membrane-bound lymphotoxin-beta receptor (LTbetaR) and CXC chemokine receptor 2 (CXCR2), is involved in type B EAE development PMID: 27820602
  5. LIGHT and LTBR interaction increases the survival and proliferation of human bone marrow-derived mesenchymal stem cells, and therefore, LIGHT might play an important role in stem cell therapy. PMID: 27835685
  6. We found that LTbetaR polymorphisms caused severe BPH. Thus, LTbetaR may contribute to the risk of BPH development. PMID: 26782510
  7. activation enhances the LPS-induced expression of IL-8 through NF-kappaB and IRF-1 PMID: 25887375
  8. LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580
  9. Relative expression of HVEM and LTbetaR modulates canonical NF-kappaB and pro-apoptotic signals stimulated by LIGHT. PMID: 24980868
  10. lymphotoxin-B-specific receptor. PMID: 24563505
  11. Dimerization of LTbetaR by LTalpha1beta2 is necessary and sufficient for signal transduction. PMID: 24248355
  12. Results suggest that blockade of lymphotoxin-beta receptor (LTBR) pathways may have therapeutic potential for treatment of Sjogren's syndrome. PMID: 22044682
  13. LTBR gene polymorphisms may be associated with risk of IgA nephropathy in Korean children PMID: 22417320
  14. show that a cognate interaction between LTalphabeta on CD4(+) helper T cells and LTbeta receptor on DCs results in unique signals that are necessary for optimal CD8(+) T-cell expansion via a type I IFN-dependent mechanism PMID: 21245292
  15. These results indicated that AdipoR1 interacted with LTBR and mediated the inhibition of LTBR-activated NF-kappaB pathway. PMID: 21195057
  16. LTbetaR levels are independently associated with atherosclerosis in multiple vascular beds PMID: 20599198
  17. Increased potential for LTbeta receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286
  18. the LTbetaR modifies the ubiquitin:NIK E3 ligase, and also acts as an allosteric regulator of the ubiquitin:TRAF E3 ligase PMID: 20348096
  19. Modulation of cellular TRAF3 levels may thus contribute to regulation of NFkappaB-dependent gene expression by LTBR by affecting the balance of LTBR-dependent activation of canonical and non-canonical NFkappaB pathways. PMID: 20185819
  20. Lymphotoxin beta receptor induces interleukin 8 gene expression via NF-kappaB and AP-1 activation.(AP-1) PMID: 12169272
  21. The NF-kappa B activation in lymphotoxin beta receptor signaling depends on the phosphorylation of p65 at serine 536. PMID: 12419817
  22. Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117
  23. GA-binding protein (GABP) and Sp1 and retinoid receptors are required to mediate retinoic acid responsiveness of CD18 transcriptional activation in myeloid cells. PMID: 12485937
  24. ASK1 is one of the factors involved in the caspase-independent pathway of LTbetaR-induced cell death. PMID: 12566458
  25. TRAF2, TRAF3, cIAP1, Smac, and lymphotoxin beta receptor associate and are involved in apoptosis PMID: 12571250
  26. LTbetaR, CD40 and TANK interact with TRAF3 at sites that promote molecular interactions driving specific signaling PMID: 14517219
  27. both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine PMID: 15917993
  28. Signaling through the lymphotoxin beta receptor (LTbetaR) expressed on mature hepatocytes induces massive hepatomegaly; LTbetaR and its ligands define a new pathway in supporting liver regeneration PMID: 16002734
  29. Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497
  30. membrane-bound receptor that mediates apoptosis (LTbetaR) was present in syncytiotrophoblast and cytotrophoblast cells in all samples but were detected in placental stromal cells only at week 8 and thereafter PMID: 17010447
  31. Evidence in this review indicates that double positive-thymocytes regulate the differentiation of early thymocyte progenitors and gamma delta T cells through a mechanism dependent on LT beta receptor. PMID: 17336158
  32. These results define a model for the study of inflammatory lymphangiogenesis in the thyroid and implicate lymphotoxin beta receptor signaling in this process. PMID: 17360402
  33. This review discusses recent studies indicating that LT beta R signaling is required for liver regeneration, hepatitis, and hepatic lipid metabolism. PMID: 17896993
  34. Lymphotoxin beta receptor ligation directly activates gene expression in human vascular endothelial cells via both noncanonical and classical NF-kappa B pathways. PMID: 18292573
  35. LTbeta-R constitutively induces NF-kappaB activation, and this event may be associated with autonomous growth of melanoma cells. PMID: 18347013
  36. lymphotoxin beta receptor (LTbetaR) was detected in Rheumatoid arthritis fibroblast-like synoviocytes PMID: 18412315

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 6718

OMIM: 600979

KEGG: hsa:4055

STRING: 9606.ENSP00000228918

UniGene: Hs.1116

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*