Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial

In Stock
Code CSB-EP013227HU1
Abbreviation Recombinant Human LTBR protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3); Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 RP; TNFR2RP; TNFR3; TNFRII; TNFRRP; TNFRSF 3; TNFRSF3; TNR3_HUMAN; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2 related protein; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor superfamily member 3 precursor; Tumor necrosis factor receptor type III
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
31-227aa
Target Protein Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.4kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 31-224 form the expressed segment for recombinant Human LTBR. This LTBR protein is theoretically predicted to have a molecular weight of 25.4 kDa. This LTBR protein is produced using e.coli expression system. The N-terminal 6xHis tag was fused into the coding gene segment of LTBR, making it easier to detect and purify the LTBR recombinant protein in the later stages of expression and purification.

The human tumor necrosis factor receptor superfamily member 3 (LTBR), belonging to the tumor necrosis factor receptor (TNFR) superfamily is a cell surface receptor involved in immune system regulation. LTBR plays a critical role in the activation of the non-canonical NF-κB signaling pathway. LTBR is primarily expressed in B cells, dendritic cells, and certain T cells. Upon binding to its ligand, lymphotoxin alpha/beta (LTα/β), LTBR triggers signaling cascades that modulate immune responses, including the development and organization of lymphoid tissues, such as lymph nodes and spleen. Research on LTBR explores its functions in immune regulation, lymphoid tissue development, and its implications in inflammatory and autoimmune diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Gene References into Functions
  1. the lymphotoxin beta receptor (LTbetaR) to elicit the fast release of NF-kappaB inducing kinase (NIK) from the receptor complex leading to non-canonical NF-kappaB signaling. PMID: 29329668
  2. these results suggest that the LTBR rs12354 polymorphism might be associated with the spontaneous resolution of hepatitis B virus infection PMID: 28575727
  3. LTBR and BCLAF1 showed higher DNA methylation percentages in the marsupialized OKCs, but this difference did not affect gene expression (P > .05). PMID: 28864293
  4. membrane-bound lymphotoxin-beta receptor (LTbetaR) and CXC chemokine receptor 2 (CXCR2), is involved in type B EAE development PMID: 27820602
  5. LIGHT and LTBR interaction increases the survival and proliferation of human bone marrow-derived mesenchymal stem cells, and therefore, LIGHT might play an important role in stem cell therapy. PMID: 27835685
  6. We found that LTbetaR polymorphisms caused severe BPH. Thus, LTbetaR may contribute to the risk of BPH development. PMID: 26782510
  7. activation enhances the LPS-induced expression of IL-8 through NF-kappaB and IRF-1 PMID: 25887375
  8. LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580
  9. Relative expression of HVEM and LTbetaR modulates canonical NF-kappaB and pro-apoptotic signals stimulated by LIGHT. PMID: 24980868
  10. lymphotoxin-B-specific receptor. PMID: 24563505
  11. Dimerization of LTbetaR by LTalpha1beta2 is necessary and sufficient for signal transduction. PMID: 24248355
  12. Results suggest that blockade of lymphotoxin-beta receptor (LTBR) pathways may have therapeutic potential for treatment of Sjogren's syndrome. PMID: 22044682
  13. LTBR gene polymorphisms may be associated with risk of IgA nephropathy in Korean children PMID: 22417320
  14. show that a cognate interaction between LTalphabeta on CD4(+) helper T cells and LTbeta receptor on DCs results in unique signals that are necessary for optimal CD8(+) T-cell expansion via a type I IFN-dependent mechanism PMID: 21245292
  15. These results indicated that AdipoR1 interacted with LTBR and mediated the inhibition of LTBR-activated NF-kappaB pathway. PMID: 21195057
  16. LTbetaR levels are independently associated with atherosclerosis in multiple vascular beds PMID: 20599198
  17. Increased potential for LTbeta receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286
  18. the LTbetaR modifies the ubiquitin:NIK E3 ligase, and also acts as an allosteric regulator of the ubiquitin:TRAF E3 ligase PMID: 20348096
  19. Modulation of cellular TRAF3 levels may thus contribute to regulation of NFkappaB-dependent gene expression by LTBR by affecting the balance of LTBR-dependent activation of canonical and non-canonical NFkappaB pathways. PMID: 20185819
  20. Lymphotoxin beta receptor induces interleukin 8 gene expression via NF-kappaB and AP-1 activation.(AP-1) PMID: 12169272
  21. The NF-kappa B activation in lymphotoxin beta receptor signaling depends on the phosphorylation of p65 at serine 536. PMID: 12419817
  22. Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117
  23. GA-binding protein (GABP) and Sp1 and retinoid receptors are required to mediate retinoic acid responsiveness of CD18 transcriptional activation in myeloid cells. PMID: 12485937
  24. ASK1 is one of the factors involved in the caspase-independent pathway of LTbetaR-induced cell death. PMID: 12566458
  25. TRAF2, TRAF3, cIAP1, Smac, and lymphotoxin beta receptor associate and are involved in apoptosis PMID: 12571250
  26. LTbetaR, CD40 and TANK interact with TRAF3 at sites that promote molecular interactions driving specific signaling PMID: 14517219
  27. both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine PMID: 15917993
  28. Signaling through the lymphotoxin beta receptor (LTbetaR) expressed on mature hepatocytes induces massive hepatomegaly; LTbetaR and its ligands define a new pathway in supporting liver regeneration PMID: 16002734
  29. Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497
  30. membrane-bound receptor that mediates apoptosis (LTbetaR) was present in syncytiotrophoblast and cytotrophoblast cells in all samples but were detected in placental stromal cells only at week 8 and thereafter PMID: 17010447
  31. Evidence in this review indicates that double positive-thymocytes regulate the differentiation of early thymocyte progenitors and gamma delta T cells through a mechanism dependent on LT beta receptor. PMID: 17336158
  32. These results define a model for the study of inflammatory lymphangiogenesis in the thyroid and implicate lymphotoxin beta receptor signaling in this process. PMID: 17360402
  33. This review discusses recent studies indicating that LT beta R signaling is required for liver regeneration, hepatitis, and hepatic lipid metabolism. PMID: 17896993
  34. Lymphotoxin beta receptor ligation directly activates gene expression in human vascular endothelial cells via both noncanonical and classical NF-kappa B pathways. PMID: 18292573
  35. LTbeta-R constitutively induces NF-kappaB activation, and this event may be associated with autonomous growth of melanoma cells. PMID: 18347013
  36. lymphotoxin beta receptor (LTbetaR) was detected in Rheumatoid arthritis fibroblast-like synoviocytes PMID: 18412315

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 6718

OMIM: 600979

KEGG: hsa:4055

STRING: 9606.ENSP00000228918

UniGene: Hs.1116

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*