Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B). The EC50 is 4.282-4.919 ng/mL.

Target Names

LTBR

Uniprot No.

P36941

Alternative Names

Tumor necrosis factor receptor superfamily member 3; Lymphotoxin-beta receptor; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor type III (TNF-RIII; TNFR-III); LTBR; D12S370, TNFCR, TNFR3, TNFRSF3

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

31-227aa

Target Protein Sequence

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Mol. Weight

50.7 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

LTBR mediates lymphotoxin-β and LIGHT signaling to regulate lymphoid organogenesis, immune homeostasis, and inflammatory responses, making it a target of interest in autoimmune disease and cancer immunotherapy research. This mammalian-expressed construct spanning residues 31–227 captures the complete extracellular ligand-binding domain and demonstrates quantified binding to biotinylated human TNFSF14 (LIGHT) with an EC50 of 4.3–4.9 ng/mL in functional ELISA, providing a validated reagent for ligand-receptor interaction studies and competitive inhibition assays. The measured affinity supports use in screening blocking antibodies, epitope mapping of therapeutic candidates targeting the LTBR–LIGHT axis, and small-molecule inhibitor discovery campaigns where precise quantification of binding interference is required. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in surface plasmon resonance, biolayer interferometry, and cell-based functional assays where contaminant interference must be minimized.

Target Background

Function

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Gene References into Functions

the lymphotoxin beta receptor (LTbetaR) to elicit the fast release of NF-kappaB inducing kinase (NIK) from the receptor complex leading to non-canonical NF-kappaB signaling. PMID: 29329668
these results suggest that the LTBR rs12354 polymorphism might be associated with the spontaneous resolution of hepatitis B virus infection PMID: 28575727
LTBR and BCLAF1 showed higher DNA methylation percentages in the marsupialized OKCs, but this difference did not affect gene expression (P > .05). PMID: 28864293
membrane-bound lymphotoxin-beta receptor (LTbetaR) and CXC chemokine receptor 2 (CXCR2), is involved in type B EAE development PMID: 27820602
LIGHT and LTBR interaction increases the survival and proliferation of human bone marrow-derived mesenchymal stem cells, and therefore, LIGHT might play an important role in stem cell therapy. PMID: 27835685
We found that LTbetaR polymorphisms caused severe BPH. Thus, LTbetaR may contribute to the risk of BPH development. PMID: 26782510
activation enhances the LPS-induced expression of IL-8 through NF-kappaB and IRF-1 PMID: 25887375
LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580
Relative expression of HVEM and LTbetaR modulates canonical NF-kappaB and pro-apoptotic signals stimulated by LIGHT. PMID: 24980868
lymphotoxin-B-specific receptor. PMID: 24563505
Dimerization of LTbetaR by LTalpha1beta2 is necessary and sufficient for signal transduction. PMID: 24248355
Results suggest that blockade of lymphotoxin-beta receptor (LTBR) pathways may have therapeutic potential for treatment of Sjogren's syndrome. PMID: 22044682
LTBR gene polymorphisms may be associated with risk of IgA nephropathy in Korean children PMID: 22417320
show that a cognate interaction between LTalphabeta on CD4(+) helper T cells and LTbeta receptor on DCs results in unique signals that are necessary for optimal CD8(+) T-cell expansion via a type I IFN-dependent mechanism PMID: 21245292
These results indicated that AdipoR1 interacted with LTBR and mediated the inhibition of LTBR-activated NF-kappaB pathway. PMID: 21195057
LTbetaR levels are independently associated with atherosclerosis in multiple vascular beds PMID: 20599198
Increased potential for LTbeta receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286
the LTbetaR modifies the ubiquitin:NIK E3 ligase, and also acts as an allosteric regulator of the ubiquitin:TRAF E3 ligase PMID: 20348096
Modulation of cellular TRAF3 levels may thus contribute to regulation of NFkappaB-dependent gene expression by LTBR by affecting the balance of LTBR-dependent activation of canonical and non-canonical NFkappaB pathways. PMID: 20185819
Lymphotoxin beta receptor induces interleukin 8 gene expression via NF-kappaB and AP-1 activation.(AP-1) PMID: 12169272
The NF-kappa B activation in lymphotoxin beta receptor signaling depends on the phosphorylation of p65 at serine 536. PMID: 12419817
Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117
GA-binding protein (GABP) and Sp1 and retinoid receptors are required to mediate retinoic acid responsiveness of CD18 transcriptional activation in myeloid cells. PMID: 12485937
ASK1 is one of the factors involved in the caspase-independent pathway of LTbetaR-induced cell death. PMID: 12566458
TRAF2, TRAF3, cIAP1, Smac, and lymphotoxin beta receptor associate and are involved in apoptosis PMID: 12571250
LTbetaR, CD40 and TANK interact with TRAF3 at sites that promote molecular interactions driving specific signaling PMID: 14517219
both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine PMID: 15917993
Signaling through the lymphotoxin beta receptor (LTbetaR) expressed on mature hepatocytes induces massive hepatomegaly; LTbetaR and its ligands define a new pathway in supporting liver regeneration PMID: 16002734
Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497
membrane-bound receptor that mediates apoptosis (LTbetaR) was present in syncytiotrophoblast and cytotrophoblast cells in all samples but were detected in placental stromal cells only at week 8 and thereafter PMID: 17010447
Evidence in this review indicates that double positive-thymocytes regulate the differentiation of early thymocyte progenitors and gamma delta T cells through a mechanism dependent on LT beta receptor. PMID: 17336158
These results define a model for the study of inflammatory lymphangiogenesis in the thyroid and implicate lymphotoxin beta receptor signaling in this process. PMID: 17360402
This review discusses recent studies indicating that LT beta R signaling is required for liver regeneration, hepatitis, and hepatic lipid metabolism. PMID: 17896993
Lymphotoxin beta receptor ligation directly activates gene expression in human vascular endothelial cells via both noncanonical and classical NF-kappa B pathways. PMID: 18292573
LTbeta-R constitutively induces NF-kappaB activation, and this event may be associated with autonomous growth of melanoma cells. PMID: 18347013
lymphotoxin beta receptor (LTbetaR) was detected in Rheumatoid arthritis fibroblast-like synoviocytes PMID: 18412315

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Database Links

HGNC: 6718

OMIM: 600979

KEGG: hsa:4055

STRING: 9606.ENSP00000228918

UniGene: Hs.1116

Code	CSB-MP013227HU1d9
Abbreviation	Recombinant Human LTBR protein, partial (Active)
MSDS	MSDS Datasheet
Size	$90
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B). The EC₅₀ is 4.282-4.919 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage