Recombinant Mouse Non-receptor tyrosine-protein kinase TYK2 (Tyk2), partial

In Stock
Code CSB-EP865636MO
Abbreviation Recombinant Mouse Tyk2 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Microbiology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
884-1174aa
Target Protein Sequence
SDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Non-receptor tyrosine-protein kinase TYK2 (Tyk2) is produced in an E. coli expression system, covering the 884-1174 amino acid region. This partial protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag for purification and detection purposes. SDS-PAGE analysis confirms the product shows purity greater than 85%, which appears suitable for various research applications.

TYK2 represents a key member of the Janus kinase (JAK) family. It plays an important role in signaling pathways for different cytokines and growth factors. The protein is involved in mediating immune responses and cellular communication, suggesting it may be valuable for understanding immune system mechanisms and signal transduction in research contexts.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant mouse TYK2 kinase domain fragment is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic kinase domains. TYK2 is a complex non-receptor tyrosine kinase that requires precise folding, proper activation loop conformation, and specific phosphorylation for its catalytic activity. The expressed fragment (884-1174aa) represents only the kinase domain with dual tags (N-terminal 10xHis and C-terminal Myc) and >85% purity. However, E. coli lacks the eukaryotic chaperones, phosphorylation machinery, and regulatory mechanisms necessary for proper kinase folding and activation. Kinase domains require precise conformational changes and often need trans-autophosphorylation or upstream kinase activation for functionality. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its kinase activity and proper folding.

1. Antibody Development and Validation

The recombinant TYK2 kinase domain can serve as an effective immunogen for generating antibodies that recognize linear epitopes within the 884-1174aa region, even if the protein is misfolded. The dual tags facilitate purification and detection. However, antibodies may not recognize conformational or phosphorylation-dependent epitopes of native, properly folded, and activated TYK2 in mouse cells. Validation against endogenous TYK2 from mammalian systems is essential.

2. Tag-Assisted Protein Interaction Studies

This application is high-risk without proper folding validation. While the dual tags enable technical feasibility for pull-down assays, if the TYK2 kinase domain is misfolded (as likely in E. coli), it will not interact physiologically with true binding partners (e.g., cytokine receptors, STAT proteins, or substrates). Kinase domains require precise conformation for specific interactions. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding and kinase activity.

3. ELISA-Based Binding Assays

This application is problematic without activity verification. If the TYK2 kinase domain is misfolded, binding assays will not reflect biological specificity. Kinase-substrate interactions require proper active site conformation. This application requires prior demonstration of proper folding and validation with known binding partners or substrates.

4. Biochemical Characterization Studies

This application is well-suited for assessing the recombinant mouse TYK2 itself. Techniques like circular dichroism spectroscopy, size-exclusion chromatography, and thermal shift assays can evaluate the protein's folding state, oligomerization, and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant product and can inform about its suitability for other applications.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this complex eukaryotic kinase domain, recommend first performing comprehensive validation: 1) Functional validation using kinase activity assays with known substrates (e.g., STAT proteins) and ATP; 2) Biophysical characterization (circular dichroism for secondary structure, analytical ultracentrifugation for oligomeric state) to assess folding quality; 3) Phosphorylation status analysis to check activation loop conformation. Antibody development can proceed immediately as the safest application. Avoid all functional studies (interactions, binding assays) until proper folding and kinase activity are confirmed. For reliable TYK2 research, obtain the kinase domain from mammalian or insect cell expression systems capable of proper folding and phosphorylation. Always include appropriate controls, such as known kinase substrates and active kinase standards, in experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-receptor kinase involved in various processes including cell growth, development, cell migration, innate and adaptive immunity. Plays both structural and catalytic roles in numerous cytokines and interferons signaling. Associates with cytokine and growth factor receptors and activate STAT family members including STAT1, STAT3, STAT4 or STAT6. The heterodimeric cytokine receptor complexes are composed of a TYK2-associated receptor chain (IFNAR1, IL12RB1, IL10RB or IL13RA1) which serves as the signal transducing chain harboring STAT docking sites once phosphorylated by TYK2, and a second receptor chain associated either with JAK1 or JAK2. In turn, recruited STATs are phosphorylated, form homo- and heterodimers, translocate to the nucleus, and regulate cytokine/growth factor responsive genes. Negatively regulates STAT3 activity by promototing phosphorylation at a specific tyrosine that differs from the site used for signaling.
Gene References into Functions
  1. TYK2 genetic variants are differentially associated with common autoimmune diseases PMID: 27807284
  2. Results show that loss of TYK2 does not affect disease severity of JAK2VF-induced murine myeloproliferative neoplasms (MPN) indicating that TYK2 has no cooperative effects with JAK2VF at the onset of MPN. PMID: 28668884
  3. mutated form which lacks tyrosine kinase activity restores differentiation of brown preadipocytes PMID: 27802075
  4. Decreased Tyk2 expression in pancreatic beta cells due to mutation determines susceptibility to virus-induced diabetes mellitus. PMID: 25849081
  5. A reduced survival fitness of the Th17 in the absence of Tyk-2 mediated by the up-regulation of SOCS3. PMID: 25109392
  6. Data indicate the important role of Tyk2 in skin inflammation and the therapeutic potential of Tyk2 inhibition in psoriasis. PMID: 24345760
  7. The conditional Tyk2 mouse strain will be instrumental to further dissect TYK2 functions in infection, inflammation and cancer. PMID: 24696087
  8. this report identifies Tyk2 as a prerequisite factor in the molecular networks that are involved in generation of IL-27. PMID: 24604832
  9. Tyk2-mediated IL-12 signaling is differentially required for the development of different Th1 cell subsets but similarly induces their bystander IFN-gamma production PMID: 24729620
  10. Expression of Tyk2 or the constitutively active form of the transcription factor Stat3 (CAStat3) restores differentiation in Tyk2(-/-) brown preadipocytes. PMID: 23217260
  11. The first mouse Tyk2 crystal structures, which are complexed to 3-aminoindazole compounds, are described. PMID: 22995073
  12. The results provide the first evidence for a role of Tyk2 in suppressing the growth and metastasis of breast cancer. PMID: 21864028
  13. important functions of Tyk2 at the molecular interface between innate immunity and cellular metabolism. PMID: 21787891
  14. gene deficiency protects joints against destruction in anti-type II collagen antibody-induced arthritis PMID: 21765170
  15. The consequent effect of SOCS1 inhibition of Tyk2 not only results in a reduced IFN response because of inhibition of Tyk2 kinase-mediated STAT signaling but also negatively impacts IFNAR1 surface expression, which is stabilized by Tyk2. PMID: 21757742
  16. A negative regulatory function is found for Tyk2 that controls IL-1ss expression in response to lipopolysaccharide at the level of translation and is probably dependent on canonical type I interferon signaling. PMID: 20713887
  17. Findings suggest an important regulatory role for Tyk2 in modulating the relationship between immunity and metabolism. PMID: 20338026
  18. Tyk2 is a Janus kinase that plays a central role in controlling the T(H)1 immune response and attenuation of Tyk2 function correlates with enhanced central nervous system repair. PMID: 20080754
  19. requirement for tyk2 for IL-12-induced NK cell activity, and for IL-18-induced NK cell activity and IFN-gamma production PMID: 11877284
  20. Tyk2 is essential for IFN-alpha-induced B lymphocyte growth inhibition, through the up-regulation and nuclear translocation of DAXX. PMID: 12391177
  21. Tyk2 plays a bilateral role in allergic inflammation in the airways by regulating Th1/Th2 balance toward the Th1-type, while it is required for induction of IL-13-mediated goblet cell hyperplasia in the airways. PMID: 12517976
  22. Data show that Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1. PMID: 12554654
  23. Differential requirements for JAK2 and TYK2 in T cell proliferation and IFN-gamma production induced by IL-12 alone or together with IL-18. PMID: 12594853
  24. Tyk2 and IFN-beta are essential effectors in LPS induced lethality. PMID: 12679810
  25. role for Tyk2 in T helper 1-mediated protective and pathogenic immune responses PMID: 14500783
  26. Limitin suppresses B-cell growth through activation of Tyk2, resulting in the up-regulation and nuclear translocation of Daxx PMID: 14662340
  27. Tyk2 is necessary for NK cell cytotoxic activity and early production of IFN-gamma by NK cells and CD8-positive T cells in L. major-infected mice but dispensable for the development of Th1 cells and for ultimate control of the infection. PMID: 14768057
  28. Tyk2 is essential for LPS-induced endotoxin shock, and this signaling pathway is transduced by the activation of Stat1 and Stat4. PMID: 15226272
  29. Tyk2 has a role in hapten-induced contact hypersensitivity in a mouse model PMID: 15488705
  30. study shows that TYK2-/- mice are tumor prone and links the increased tumor susceptibility to tumor surveillance; define TYK2 as a key molecule in B lymphoid malignancy PMID: 15578097
  31. In addition to the established role of Tyk2 as an amplifier of Jak/Stat signaling upon IFN-alphabeta stimulation, there is a novel role of Tyk2 as a modifier of host responses PMID: 16148148
  32. Tyk2 is critical for optimal IL-10-mediated signaling and suppressor function. PMID: 16751369
  33. Our results implicate a novel role for Tyk2 kinase and Stat3 phosphorylation in mitochondrial respiration. PMID: 16982690
  34. The defective Tyk2 signaling in the host environment was at least partially responsible for the impaired CD8+ T cytotoxic-1 (Tc1) cell responses in Tyk2-/- mice following the infection. PMID: 17048270
  35. Tyk2 signaling for IFN-gamma production in host environment plays an important role in contraction of effector CD8+ T cells following a microbial infection. PMID: 17372006
  36. Expression of Tyk2 in dendritic cellss is crucial for the production of Th1-promoting cytokines such as IL-12 and IFN-gamma. PMID: 17395783
  37. data suggest iNOS (inducible nitric oxide synthase) is induced through IFNAR1 & TYK2 in Mac3-positive cells, the main source of iNOS in spleen and lung; LPS-induced iNOS expression in liver is independent of IFNAR1 & partially dependent on TYK2 PMID: 18086385
  38. Tumor-induced suppressor of cytokine signaling 3 inhibits toll-like receptor 3 signaling in dendritic cells via binding to tyrosine kinase 2. PMID: 18593942
  39. Tyk2-signaling is critical for IL-23-induced IL-17 production by gammadelta T cells PMID: 18641345
  40. The data suggest a selective contribution of Tyk2 to the activation of inflammation-relevant cell types by LPS. PMID: 18845149
  41. Tyk2 is a shared autoimmune disease susceptibility gene whose genetic contribution to disease susceptibility can be modified by environmental factors PMID: 19494301
  42. Tyk2 is critically involved in the pathogenic CD4 T cell responses in experimental autoimmune encephalomyelitis PMID: 19917699

Show More

Hide All

Protein Families
Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*