Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP023986MO |
| Product Type | Recombinant Protein |
| Size | US$2466 |
| Uniprot No. | O35235 |
| Lead Time | 3-7 business days |
| Relevance | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Osteoclast differentiation factor Short name:ODF Osteoprotegerin ligand Short name:OPGL Receptor activator of nuclear factor kappa-B ligand Short name:RANKL TNF-related activation-induced cytokine Short name:TRANCE CD_antigen: CD254 |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Research Area | Others |
| Source | E.coli |
| Gene Names | Tnfsf11 |
| Expression Region | 70-316aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Mol. Weight | 43.9kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts |
| Involvement in disease | Deficiency in Tnfsf11 results in failure to form lobulo-alveolar mammary structures during pregnancy, resulting in death of newborns. Trance-deficient mice show severe osteopetrosis, with no osteoclasts, marrow spaces, or tooth eruption, and exhibit profound growth retardation at several skeletal sites, including the limbs, skull, and vertebrae and have marked chondrodysplasia, with thick, irregular growth plates and a relative increase in hypertrophic chondrocytes. |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted |
| Protein Families | Tumor necrosis factor family |
| Tissue Specificity | Highly expressed in thymus and lymph nodes, but not in non-lymphoid tissues and is abundantly expressed in T-cells but not in B-cells. A high level expression is also seen in the trabecular bone and lung. |
| Database Links |
KEGG: mmu:21943 STRING: 10090.ENSMUSP00000022592 UniGene: Mm.249221 |
| Pathway |
NF-kappa B signaling pathway
Osteoclast differentiation |
Tnfsf11 Antibodies for Mus musculus (Mouse)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA07964A0Rb | Tnfsf11 Antibody | Mouse | ELISA |
| CSB-PA07964B0Rb | Tnfsf11 Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA07964C0Rb | Tnfsf11 Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA07964D0Rb | Tnfsf11 Antibody, Biotin conjugated | Mouse | ELISA |
| CSB-PA023986LB01MO | Tnfsf11 Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA023986LC01MO | Tnfsf11 Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA023986LD01MO | Tnfsf11 Antibody, Biotin conjugated | Mouse | ELISA |
Tnfsf11 Antibodies for Mouse
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA023986LA01MO | Tnfsf11 Antibody | Mouse | ELISA, IF |
Tnfsf11 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-AP005011MO | Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11),partial (Active) | E.coli |
| CSB-AP005021MO | Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11),partial (Active) | Mammalian cell |
| CSB-YP023986MO CSB-BP023986MO CSB-MP023986MO |
Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11),partial | Yeast Baculovirus Mammalian cell |
| CSB-CF023986MO(A4) | Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11) | in vitro E.coli expression system |
Tnfsf11 ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E05127m | Mouse soluble receptor activator of nuclear factor-kB ligand,sRANKL ELISA Kit | serum, plasma, cell culture supernates, tissue homogenates | 3.9 pg/mL |
Recombinant Human Keratin, type II cytoskeletal 7(KRT7)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor XIII A chain(F13A1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human T cell receptor alpha constant(TRAC)
Express system: E.coli
Species: Homo sapiens (Human)
