Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Tnfsf11; Opgl; Rankl; Trance; Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD antigen CD254) [Cleaved into: Tumor necrosis factor ligand superfamily member 11; membrane form; Tumor necrosis factor ligand superfamily member 11; soluble form]
Species
Mus musculus (Mouse)
Expression Region
70-316aa
Target Protein Sequence
YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 70-316 form the expressed segment for recombinant Mouse Tnfsf11. The calculated molecular weight for this Tnfsf11 protein is 43.9 kDa. This Tnfsf11 protein is produced using e.coli expression system. The Tnfsf11 coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant Tnfsf11 protein in following stages of expression and purification.
Tumor necrosis factor ligand superfamily member 11 (Tnfsf11), also known as RANKL, is a key cytokine involved in the regulation of bone metabolism. It plays a crucial role in the differentiation and activation of osteoclasts, the cells responsible for bone resorption. RANKL binds to its receptor RANK on the surface of osteoclast precursors, triggering a signaling cascade that promotes osteoclast formation, function, and survival. Additionally, RANKL is essential for various physiological processes, including the development of lymph nodes and the mammary gland. Research on Tnfsf11 spans multiple areas, such as bone biology, immune system regulation, and reproductive physiology. In bone biology, investigations focus on understanding how RANKL signaling influences bone remodeling and its implications for diseases like osteoporosis and arthritis. In the immune system, RANKL is involved in the regulation of lymphoid tissue development and the immune response. Moreover, studies exploring the role of RANKL in reproductive physiology highlight its importance in mammary gland development and lactation. Targeting the RANKL/RANK pathway has therapeutic potential for bone-related disorders.