Purity
            Greater than 95% as determined by SDS-PAGE.
           
                              
            Endotoxin
            Less than 1.0 EU/μg as determined by LAL method.
           
                              
            Activity
            The ED50 as determined by its ability to bind Human TNFRSF11B in functional ELISA is less than 10 ug/ml.
           
                              
                                                  
                                        
                              
            Alternative Names
            
              Tnfsf11; Opgl; Rankl; Trance; Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD antigen CD254) [Cleaved into: Tumor necrosis factor ligand superfamily member 11; membrane form; Tumor necrosis factor ligand superfamily member 11; soluble form]
             
           
                                        
            Species
            Mus musculus (Mouse)
           
                              
                              
            Expression Region
            73-316aa
           
                              
            Complete Sequence            
            AQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID            
           
                              
                              
                                        
            Tag Info
            
                                          N-terminal 6xHis-tagged
                          
           
                              
            Form
            
                            Liquid or Lyophilized powder                                        
           
                    
            Buffer
                          Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.                          
           
                                                  
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
             Basically, we can dispatch the products
              out in 1-3
              working days after receiving your orders. Delivery time may differ from different purchasing way or
              location, please kindly consult your local distributors for specific delivery time.
              Note: All of our proteins are default shipped with
                normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
                and extra fees will be charged.            
           
                    
            Datasheet & COA
             Please contact us to get it.