Recombinant Human T-cell-specific surface glycoprotein CD28(CD28)

Code CSB-CF004913HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P10747
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Source in vitro E.coli expression system
Gene Names CD28
Protein Names Recommended name: T-cell-specific surface glycoprotein CD28 Alternative name(s): TP44 CD_antigen= CD28
Expression Region 19-220
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation
Subcellular Location Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell surface
Tissue Specificity Expressed in T-cells and plasma cells, but not in less mature B-cells.
Database Links

HGNC: 1653

OMIM: 186760

KEGG: hsa:940

STRING: 9606.ENSP00000324890

UniGene: Hs.443123

Pathway T cell receptor signaling pathway
Inhibitors of axonal regeneration

Related Products

CD28 Antibodies

CD28 Antibodies for Homo sapiens (Human)

CD28 Proteins

CD28 Proteins for Homo sapiens (Human)

CD28 ELISA Kit

CD28 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.