Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15 ng/mL.
Alternative Names
AMCFII; C-X-C motif chemokine 5; C-X-C motif chemokine ligand 5; Chemokine (C X C motif) ligand 5; chemokine (C-X-C motif) ligand 5; Cxcl5; CXCL5_HUMAN; ENA 78; ENA-78 (8-78); ENA-78(1-78); ENA-78(9-78); ENA78; Epithelial derived neutrophil activating protein 78; Epithelial-derived neutrophil-activating protein 78; Lipopolysaccharide-induced CXC chemokine; Neutrophil activating peptide ENA 78 ; Neutrophil activating protein 78; Neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; Small inducible cytokine B5 ; small inducible cytokine subfamily B (Cys-X-Cys); member 5 (epithelial-derived neutrophil-activating peptide 78); small inducible cytokine subfamily B; member 5; Small-inducible cytokine B5
Species
Homo sapiens (Human)
Expression Region
44-114aa
Complete Sequence
LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Buffer
Lyophilized from a 0.2 μm filtered 20mM Citrate,8% Trehalose,4% Mannitol,50mM NaCl,0.05% Tween 80,pH 5.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage
temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.