Recombinant Human C-X-C motif chemokine 5(CXCL5),partial

In Stock
Code CSB-AP003561HU
Product Type Chemokine
Size US$124
Uniprot No. P42830
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, pH 6.0
Alias C-X-C Motif Chemokine 5; ENA-78 (1-78); Epithelial-Derived Neutrophil-Activating Protein 78; Neutrophil-Activating Peptide ENA-78; Small-Inducible Cytokine B5; ENA-78 (8-78); ENA-78 (9-78); CXCL5; ENA78; SCYB5
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Research Area Immunology
Source E.coli
Gene Names CXCL5
Expression Region 44-114aa
Tag Info Tag-Free
Mol. Weight 7.95 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 10642

OMIM: 600324

KEGG: hsa:6374

STRING: 9606.ENSP00000296027

UniGene: Hs.89714

Pathway Chemokine signaling pathway
TNF signaling pathway
IL-17 signaling pathway

Related Products

CXCL5 Antibodies

CXCL5 Antibodies for Human

CXCL5 Antibodies for Homo sapiens (Human)

CXCL5 Proteins

CXCL5 Proteins for Homo sapiens (Human)

CXCL5 ELISA Kit

CXCL5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.