Recombinant Human C-X-C motif chemokine 5(CXCL5),partial

In Stock
Code CSB-EP006250HU1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P42830
Relevance Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP061574h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CXCL5.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP061574h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CXCL5.
Storage Buffer Tris-based buffer,50% glycerol
Alias ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
Source E.coli
Gene Names CXCL5
Expression Region 37-110aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 10642

OMIM: 600324

KEGG: hsa:6374

STRING: 9606.ENSP00000296027

UniGene: Hs.89714

Pathway Chemokine signaling pathway
TNF signaling pathway
IL-17 signaling pathway

Related Products

CXCL5 Antibodies

CXCL5 Antibodies for Human

CXCL5 Antibodies for Homo sapiens (Human)

CXCL5 Proteins

CXCL5 Proteins for Homo sapiens (Human)

CXCL5 ELISA Kit

CXCL5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.