Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial

In Stock
Code CSB-AP003641MO
Product Type Colony Stimulating Factor
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P07141
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Macrophage colony-stimulating factor 1;CSF-1;MCSF;Csf1;Csfm
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using M?NFS?60 mouse myelogenous leukemia lymphoblast cells is less than 10 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Research Area Immunology
Source Mammalian cell
Gene Names Csf1
Expression Region 33-262aa
Tag Info Tag-Free
Mol. Weight 26 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Involvement in disease A defect in Csf1 is the cause of osteopetrosis. Osteopetrotic mice (op/op) are severely deficient in mature macrophages and osteoclasts, display failed tooth eruption, and have a restricted capacity for bone remodeling.
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed macrophage colony-stimulating factor 1: Secreted, extracellular space
Database Links

KEGG: mmu:12977

STRING: 10090.ENSMUSP00000014743

UniGene: Mm.795

Pathway Ras signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
TNF signaling pathway
Hematopoietic cell lineage
Osteoclast differentiation
Rap1 signaling pathway

Related Products

Csf1 Antibodies

Csf1 Antibodies for Mouse

Csf1 Proteins

Csf1 Proteins for Mus musculus (Mouse)

Csf1 ELISA Kit

Csf1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.