Recombinant Human Platelet-derived growth factor subunit B(PDGFB) (Active)

In Stock
Code CSB-AP003821HU
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01127
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 4 mM HCl
Alias Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 50 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Research Area Cancer
Source E.coli
Gene Names PDGFB
Expression Region 82-190aa
Tag Info Tag-Free
Mol. Weight 12.42 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin
Involvement in disease Basal ganglia calcification, idiopathic, 5 (IBGC5)
Subcellular Location Secreted
Protein Families PDGF/VEGF growth factor family
Tissue Specificity Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.
Database Links

HGNC: 8800

OMIM: 190040

KEGG: hsa:5155

STRING: 9606.ENSP00000330382

UniGene: Hs.1976

Pathway Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Ras signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

PDGFB Antibodies

PDGFB Antibodies for Homo sapiens (Human)

PDGFB Proteins

PDGFB Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.