Recombinant Mouse Interleukin-1 beta(Il1b)

In Stock
Code CSB-AP004731MO
Product Type Interleukin
Size US$195
Uniprot No. P10749
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm Filtered 50 mM Tris-HCl, 50 mM NaCl, pH 8.0
Alias Interleukin-1 Beta; IL-1 Beta; Il1b
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Research Area Immunology
Source E.coli
Gene Names Il1b
Expression Region 118-269aa
Tag Info Tag-Free
Mol. Weight 17.4 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
Subcellular Location Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted
Protein Families IL-1 family
Tissue Specificity Expressed in activated macrophages (at protein level).
Database Links

KEGG: mmu:16176

STRING: 10090.ENSMUSP00000028881

UniGene: Mm.222830

Pathway MAPK signaling pathway
Lipids and Inflammation in Atherogenesis
NF-kappa B signaling pathway
TNF signaling pathway
Necroptosis
Hematopoietic cell lineage
IL-17 signaling pathway
Inflammasome Signaling
NOD-like receptor signaling pathway
Osteoclast differentiation
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Excitatory synapse pathway

Related Products

Il1b Antibodies

Il1b Antibodies for Mouse

Il1b Proteins

Il1b Proteins for Mus musculus (Mouse)

Il1b ELISA Kit

Il1b ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.