Recombinant Mouse Interleukin-1 beta(Il1b),partial

Code CSB-RP173474m
Product Type Recombinant Protein
Size US$2466
Uniprot No. P10749
Relevance Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS
Research Area Others
Source E.coli
Gene Names Il1b
Expression Region 119-268aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 21.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
Subcellular Location Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted
Protein Families IL-1 family
Tissue Specificity Expressed in activated macrophages (at protein level).
Database Links

KEGG: mmu:16176

STRING: 10090.ENSMUSP00000028881

UniGene: Mm.222830

Pathway MAPK signaling pathway
Lipids and Inflammation in Atherogenesis
NF-kappa B signaling pathway
TNF signaling pathway
Necroptosis
Hematopoietic cell lineage
IL-17 signaling pathway
Inflammasome Signaling
NOD-like receptor signaling pathway
Osteoclast differentiation
Th17 cell differentiation
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Excitatory synapse pathway

Related Products

Il1b Antibodies

Il1b Antibodies for Mouse

Il1b Proteins

Il1b Proteins for Mus musculus (Mouse)

Il1b ELISA Kit

Il1b ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.