Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody(CSB-RA001707MA01HU), the EC50 is 0.6666-0.8876 ng/mL.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-496aa
Target Protein Sequence
YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The product CSB-MP001707HU(A4) is a recombinant human angiopoietin-2(ANGPT2) protein expressed in mammalian cells. This protein carries a C-terminal 10xHis-tag. Its expression region encodes the 19-496aa of the human ANGPT2 protein. In the functional ELISA, this ANGPT2 protein binds to the anti-ANGPT2 recombinant antibody, with the EC50 of 0.6666-0.8876 ng/mL. This demonstrates that it is an active protein. It reached up to 90% in purity measured by SDS-PAGE. Its endotoxin level was determined to be less than 1.0 EU/ug using the LAL method.
ANGPT2 is an angiogenesis factor that regulates endothelial cell differentiation, survival, and stability. It is mainly expressed in endothelial cells. As a natural competitive antagonist of ANGPT1, ANGPT2 competitively inhibits the TIE2 phosphorylation of ANGPT1. ANGPT2 can maintain the dynamic balance of blood vessel growth and degeneration by inhibiting the activation of ANGPT1. ANGPT2/TIE2 signaling pathway plays an important role in tumor angiogenesis, sprouting, persistence, and metastasis. A complementary pathway recently explored as a potential new drug target is the ANGPT2/TIE2 axis, which helps regulate vascular permeability and inflammation.