Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-MP019093HU(M) |
Size | $428 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This Human PVR (PVS) recombinant protein was produced in Mammalian cell, where the gene sequence encoding human PVR [21-343aa(I340M)] was expressed with the C-terminal hFc tag. The purity of this recombinant PVR (CD155) was greater than 95% by SDS-PAGE. The activity was validated. PVR is expressed in a variety of tissues and cells, such as the small intestine, lung, liver, heart, spinal cord neurons, and skeletal muscle motor endplates, as well as in the notochord, floor plate, neural tube, and visual system in the central nervous system. Initial studies found that PVR molecules are highly expressed in colon cancer cells and glioblastoma cells, and more types of tumors have been studied, such as tumors of the prostate, kidney, pancreas, lung, ovary, thymus, and brain. The results show that PVR molecules are highly expressed on various tumor cells and play a role in the occurrence and development of tumors. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT. |
Target Names | PVR |
Uniprot No. | P15151 |
Alternative Names | PVR; PVS; Poliovirus receptor; Nectin-like protein 5; NECL-5; CD antigen CD155 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 21-343aa(I340M) |
Target Protein Sequence | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN |
Mol. Weight | 64.0 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytotoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.; (Microbial infection) Acts as a receptor for poliovirus. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.; (Microbial infection) Acts as a receptor for Pseudorabies virus.; (Microbial infection) Is prevented to reach cell surface upon infection by Human cytomegalovirus /HHV-5, presumably to escape immune recognition of infected cell by NK cells.
|
Gene References into Functions |
|
Subcellular Location | [Isoform Alpha]: Cell membrane; Single-pass type I membrane protein.; [Isoform Delta]: Cell membrane; Single-pass type I membrane protein.; [Isoform Beta]: Secreted.; [Isoform Gamma]: Secreted. |
Protein Families | Nectin family |
Database Links |
HGNC: 9705 OMIM: 173850 KEGG: hsa:5817 STRING: 9606.ENSP00000402060 UniGene: Hs.171844 |