Recombinant Bovine Interleukin-7 (IL7)

In Stock
Code CSB-EP011669BO
Abbreviation Recombinant Bovine IL7 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IL-7
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
26-176aa
Target Protein Sequence
DCDISGKDGGAYQNVLMVNIDDLDNMINFDSNCLNNEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLSTVSQGTLTLLNCTSKGKGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRGIKEH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Interleukin-7 (IL7) is produced in E. coli and consists of the full length of the mature protein, spanning amino acids 26 to 176. This protein is tagged with an N-terminal 6xHis-tag, which makes purification and detection more straightforward. The product shows a purity greater than 85% as determined by SDS-PAGE, though this appears to provide adequate reliability for experimental applications. It is intended for research use only and is not suitable for human or veterinary use.

Interleukin-7 represents a key cytokine in immune response regulation. The protein plays what seems to be a significant role in T cell and B cell development and homeostasis. This makes it particularly valuable when studying immune system functions and disorders. IL7 is actively researched for its involvement in immune cell proliferation and survival, as well as its potential applications in immunotherapy and vaccine development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Bovine Immune Cell Proliferation and Activation Studies

This recombinant bovine IL-7 may be used to investigate how bovine T lymphocytes and B cell precursors respond to proliferation and activation signals in vitro. Researchers can culture bovine peripheral blood mononuclear cells or isolated lymphocyte populations with varying concentrations of this IL-7 to assess dose-dependent cellular responses. The species-matched cytokine likely ensures physiologically relevant interactions with bovine IL-7 receptors. This characteristic appears valuable for studying bovine immunology and lymphocyte development mechanisms.

2. Comparative Cytokine Function Analysis Across Species

The bovine IL-7 protein can serve as a comparative tool in cross-species cytokine research, allowing investigators to examine functional differences between bovine and human or murine IL-7 signaling pathways. Researchers might perform parallel experiments using bovine, human, and mouse IL-7 on respective immune cell populations to identify species-specific receptor binding affinities and downstream signaling cascades. This application seems particularly useful for understanding evolutionary conservation and divergence of IL-7 function across mammalian species.

3. Anti-Bovine IL-7 Antibody Development and Validation

The N-terminal His-tagged recombinant protein can work as an immunogen for generating specific antibodies against bovine IL-7 or as a standard for validating existing antibodies. The His-tag makes purification and immobilization more manageable for ELISA-based antibody screening and characterization assays. Researchers developing bovine-specific immunoassays or studying IL-7 expression in bovine tissues would likely benefit from this standardized antigen for antibody production and validation protocols.

4. Protein-Protein Interaction Studies with Bovine IL-7 Receptor Components

This recombinant protein can be used in biochemical binding assays to characterize interactions between bovine IL-7 and its receptor subunits, including the IL-7 receptor alpha chain and common gamma chain. The His-tag enables pull-down experiments and surface plasmon resonance studies to determine binding kinetics and affinities. Such studies would contribute to understanding the molecular basis of IL-7 signaling in bovine systems. The results could inform research on cytokine receptor biology, though more work may be needed to fully characterize these interactions.

5. Bovine Cell Culture Medium Supplementation for Research Applications

The recombinant bovine IL-7 can work as a defined supplement in specialized cell culture media for maintaining or expanding bovine lymphocyte populations in vitro. Researchers studying bovine immune responses, vaccine development, or cellular immunology can incorporate this cytokine to support the survival and proliferation of IL-7-dependent bovine immune cells. The species-matched origin appears to ensure optimal biological compatibility for long-term bovine cell culture applications, though individual optimization may still be necessary.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location
Secreted.
Protein Families
IL-7/IL-9 family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*