Recombinant Bovine Interleukin-7 (IL7)

In Stock
Code CSB-EP011669BO
Abbreviation Recombinant Bovine IL7 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IL-7
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
26-176aa
Target Protein Sequence
DCDISGKDGGAYQNVLMVNIDDLDNMINFDSNCLNNEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLSTVSQGTLTLLNCTSKGKGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRGIKEH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Interleukin-7 (IL7) is produced in E. coli and consists of the full length of the mature protein, spanning amino acids 26 to 176. This protein is tagged with an N-terminal 6xHis-tag, which makes purification and detection more straightforward. The product shows a purity greater than 85% as determined by SDS-PAGE, though this appears to provide adequate reliability for experimental applications. It is intended for research use only and is not suitable for human or veterinary use.

Interleukin-7 represents a key cytokine in immune response regulation. The protein plays what seems to be a significant role in T cell and B cell development and homeostasis. This makes it particularly valuable when studying immune system functions and disorders. IL7 is actively researched for its involvement in immune cell proliferation and survival, as well as its potential applications in immunotherapy and vaccine development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Bovine IL-7 is a eukaryotic cytokine that requires precise folding, proper disulfide bond formation, and specific tertiary structure for functional activity in lymphocyte proliferation and survival signaling. The E. coli expression system lacks eukaryotic folding machinery and may not support correct disulfide bond formation or post-translational modifications. However, studies confirm that bovine IL-7 expressed in E. coli can be refolded and purified to retain bioactivity, demonstrating the ability to induce Bcl2/NFATc1 expression and STAT3 phosphorylation in bovine immune cells. The N-terminal 6xHis tag is small and unlikely to cause significant steric interference. While the full-length mature protein (26-176aa) contains all functional domains, the probability of correct folding with functional bioactivity is high only if optimized refolding protocols are applied. Without refolding, the protein may be misfolded and inactive.

1. Bovine Immune Cell Proliferation and Activation Studies

This application is suitable if bioactivity is validated. E. coli-expressed bovine IL-7 has been shown to stimulate lymphocyte proliferation and activate signaling pathways (e.g., STAT3 phosphorylation) in bovine PBMCs. However, if the protein is misfolded due to improper refolding (unverified), it will fail to elicit physiological responses.

2. Comparative Cytokine Function Analysis Across Species

This application is feasible due to IL-7’s functional conservation across species. Bovine IL-7 can be compared with human/murine IL-7 in cross-species assays, as seen in studies using human IL-7 receptors to test bovine IL-7 activity. However, species-specific differences in glycosylation or folding may affect direct comparisons if the recombinant protein lacks native conformation.

3. Anti-Bovine IL-7 Antibody Development and Validation

This application is highly suitable. The recombinant protein serves as an effective immunogen for generating antibodies, as demonstrated in studies developing IL-7-specific monoclonal antibodies for other species. Linear epitopes are accessible even without perfect folding, and the His-tag simplifies purification for immunization.

4. Protein-Protein Interaction Studies with Bovine IL-7 Receptor Components

This application carries a risk without functional validation. IL-7 binding to its receptor (IL-7Rα/γc) requires precise tertiary structure. If correctly refolded (verified), the protein can be used in SPR or pull-down assays to study binding kinetics. If misfolded (unverified), interactions may be non-specific or absent.

5. Bovine Cell Culture Medium Supplementation for Research Applications

This application is supported by evidence. Recombinant bovine IL-7 can maintain lymphocyte viability in culture, as shown in studies where IL-7 extended the functionality of bovine immune cells in IFN-γ assays. However, optimal concentrations must be determined empirically to avoid overstimulation or toxicity.

Final Recommendation & Action Plan

The E. coli-expressed bovine IL-7 with a His-tag can be biologically active if properly refolded and validated, as demonstrated in peer-reviewed studies . Prioritize refolding protocols and bioactivity checks (e.g., lymphocyte proliferation assays or STAT3 phosphorylation tests) before functional applications. Applications 3 and 5 can proceed immediately, while Applications 1, 2, and 4 require experimental validation. For reliable results, use a mammalian-cell-expressed IL-7 for studies requiring native glycosylation or complex folding, and always include positive controls in assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location
Secreted.
Protein Families
IL-7/IL-9 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*