Recombinant Chicken Interleukin-8(CXCL8),partial

Code CSB-EP011671CH1
Product Type Recombinant Protein
Size US$2466
Uniprot No. P08317
Relevance May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chotactic for peripheral blood mononuclear cells as well as for heterophils.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1 ;EMF-1
Species Gallus gallus (Chicken)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP
Research Area Others
Source E.coli
Gene Names CXCL8
Expression Region 17-102aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 13.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

KEGG: gga:396495

STRING: 9031.ENSGALP00000019051

UniGene: Gga.826

Pathway Chemokine signaling pathway
NF-kappa B signaling pathway
Cellular senescence
IL-17 signaling pathway
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Oxidative Phosphorylation
Phospholipase D signaling pathway

Related Products

CXCL8 Antibodies

CXCL8 Antibodies for Gallus gallus (Chicken)

CXCL8 Proteins

CXCL8 Proteins for Gallus gallus (Chicken)

CXCL8 ELISA Kit

CXCL8 ELISA Kit for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.