Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

In Stock
Code CSB-EP014597HU
Abbreviation Recombinant Human MKI67 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MKI67
Uniprot No.
Research Area
Others
Alternative Names
Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3120-3256aa
Target Protein Sequence
NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 3120-3256 form the expressed segment for recombinant Human MKI67. The calculated molecular weight for this MKI67 protein is 19.4 kDa. The MKI67 protein was expressed in e.coli. The MKI67 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant MKI67 protein during the following stages.

The human proliferation marker protein Ki-67, encoded by the MKI67 gene, is a widely utilized marker for cellular proliferation. Ki-67 is present during all active phases of the cell cycle (G1, S, G2, and mitosis) but absent in the resting phase (G0). It serves as a nuclear marker for assessing and quantifying the proliferative activity of cells, playing a crucial role in cancer diagnosis and prognosis. Researchers often employ Ki-67 immunohistochemistry to evaluate the growth fraction of tumors and determine their aggressiveness. Beyond cancer research, Ki-67 is also explored in studies related to cell cycle regulation, apoptosis, and various physiological and pathological processes associated with cell proliferation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly. Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface. Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility. Binds DNA, with a preference for supercoiled DNA and AT-rich DNA. Does not contribute to the internal structure of mitotic chromosomes. May play a role in chromatin organization. It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable).
Gene References into Functions
  1. RAGE, EGFR and Ki-67 were immunohistochemicalyl studied for their expression in biopsy specimens from primary breast tumors PMID: 30139236
  2. High Ki-67 expression is associated with Central Giant Cell Granuloma. PMID: 30139237
  3. Our results identified FGFR3(high)/Ki67(high) papillary pTa tumors as a subgroup with poor prognosis and encourage histological grading as high grade tumors. PMID: 30154342
  4. PD-L1, Ki-67, and p53 staining individually had significant prognostic value for patients with stage II and III colorectal cancer PMID: 28782638
  5. Studies indicate that high Ki-67 expression was correlated with poor prognosis and advanced clinicopathological features, and it could serve as a biomarker for disease management [Review]. PMID: 28287186
  6. High Ki67, EZH2, and SMYD3 immunoexpression, adjusted for standard clinicopathological parameters, independently predicts outcome in patients with prostate cancer, at diagnosis. PMID: 29174711
  7. the combination of the TERT promoter/BRAFV600E mutations and Ki-67 LI is a promising marker to predict recurrence of PTC. PMID: 28150740
  8. p16/Ki-67 dual immunostaining had comparable sensitivity and improved specificity in screening high-grade cervical intraepithelial neoplasm (HGCIN) or CC when compared with hrHPV detection. Further studies may be beneficial to assess the efficacy of this novel biomarker, which can be potentially used as one of the initial screening assays. PMID: 30249873
  9. We show that it is possible to approximate the true Ki67 Index accurately without detecting individual nuclei and also statically demonstrate the weaknesses of commonly adopted approaches that use both tumor and non-tumor regions together while compensating for the latter with higher order approximations PMID: 30176814
  10. Prognosis of luminal breast carcinoma can be predicted using Ki67 as a continuous variable and a standard cut-off value of 14%. Information about the specimen type used to determine ki67 should be recorded in the pathological report PMID: 28865009
  11. Ki-67 and TOPO 2A expression correlated with tumour size and tumour invasiveness in somatotropinomas. PMID: 29334118
  12. The aim of this study was to investigate the expression of p16 and SATB1 proteins in regard to expression of the Ki-67 antigen and available clinicopathological data (i.a. receptor status, staging and grading PMID: 29936452
  13. Data suggest that Ki-67 is a strong prognostic factor for overall survival (OS) and disease-free survival (DFS) and should be included in all pancreatic neuroendocrine tumor pathology. PMID: 29351120
  14. Ki-67-a proliferation marker is easily identified and provides comparable accurate information. In contrast to poor reproducibility of mitotic counts, Ki-67 can achieve high agreement between pathologists; is more reproducible; adds complementary value to the MBR grading system and correlates well with other clinicopathologic parameters. PMID: 29893312
  15. High Ki-67 expression is associated with papillary thyroid carcinoma. PMID: 29855303
  16. This study demonstrated that p16/Ki-67 dual staining represents an effective method for cervical cancer screening. Application of this method could lead to a reduction of unnecessary colposcopy referrals and misdiagnosis. PMID: 29758205
  17. In human adenocarcinoma tissues, PFKFB3 and Ki67 protein levels were related to the clinical characteristics and overall survival PMID: 29327288
  18. In leukoplakia, the expression of survivin associated with that of ki-67 reinforces the assumption that all these lesions are potentially malignant. PMID: 28346726
  19. High Ki67 expression in the index prostate cancer lesion is an independent predictor of biochemical recurrence in patients with positive surgical margin following radical prostatectomy. PMID: 29506507
  20. Ki-67 expression level failed to have a markedly significant impact on survival in patients with extensive-stage small cell lung cancer PMID: 28589765
  21. p16/Ki-67 dual staining can increase the efficiency of screening methods for cervical cancer. PMID: 29895125
  22. both the value and the level of Ki-67 expression were correlated positively with the normalized iodine concentration (NIC) values (r=0.344, P=0.002 and r=0.248, P=0.026); HIF-1alpha expression was correlated positively with the NIC values of the RC (r=0.598, P<0.001) PMID: 29103468
  23. According to immunohistochemistry and immunoblot analysis, the expression levels of cyclin D1, cyclin E, pRb, and Ki67 in psoriasis lesions decreased after treatment and were similar with those in the normal group PMID: 29115643
  24. Studies suggest that Ki-67 acts as an organiser of chromosome periphery region [Review]. PMID: 28838621
  25. High Ki-67 immunohistochemical expression levels in distant metastatic lesions were independently associated with poorer overall survival outcomes after biopsy of recurrence lesion in breast cancer patients. PMID: 28425014
  26. Data show there was no trend to higher Ki-67 antigen in metastatic than primary pancreatic neuroendocrine tumors (NETs). PMID: 28984786
  27. Data suggest that Ki-67 antigen proliferative index has important limitations and hhosphohistone H3 (PHH3) is an alternative proliferative marker. PMID: 29040195
  28. A high Ki-67 LI correlated significantly with a worse prognosis in gastric cancer (GC)patients. Further cumulative studies for the optimal cutoff value for high Ki-67 LI are needed before application in clinical practice. PMID: 28561880
  29. Ki67 expression in gastric carcinoma is directly correlated with the tumor grade and depth of invasion. PMID: 28965621
  30. In ACTH-secreting pituitary tumors, Ki-67 was expressed in 7 of 28 recurrent tumors and 8 of 27 nonrecurrent tumors, and there was no staining in normal pituitary samples. It was expressed predominantly in the nucleus of the tumor cells. There was no significant difference between Ki67 expression between the nonrecurrent group and the recurrent group. PMID: 29432944
  31. Adjuvant chemotherapy was 9% less likely to be recommended by a multidisciplinary board when using the current criteria compared with using a combination of the St. Gallen criteria and Ki67 and uPA/PAI-1 status (P = 0.03). Taken together, our data show discordance among markers in identifying the risk of recurrence, even though each marker may prove to be independently valid. PMID: 28954632
  32. The different values of the cycling nuclear area major dimension may also be connected with the biological behaviour of the three examined groups. Moreover, the endometrial epithelial cells may follow a Ki-67 increase pathway, instead of the relatively stable pathway which the rapidly proliferating adenocarcinoma cells may use. PMID: 28737230
  33. Age-associated expression of the proliferation and immature neuron markers MKI67 and DCX, respectively, was unrelated, suggesting that neurogenesis-associated processes are independently altered at these points in the development from stem cell to neuron. PMID: 28766905
  34. High Ki-67 expression in localized PCa is a factor of poor prognosis for prostate cancer PMID: 28648414
  35. Dual p16 and Ki-67 expression can be used in cervical screening of HPV-positive women. PMID: 29566392
  36. The expression of alpha-enolase, Ki67 and p53 in pancreatic cancer and adjacent normal tissues were evaluated by IHC using the corresponding primary antibodies on the commercial tissue arrays PMID: 28824297
  37. All cases of DF showed much higher Ki67 proliferation index (P = 0.0001) along with increased mitotic figures both on H&E and with anti-PHH3 PMID: 28609344
  38. We performed immunohistochemistry for Ki67, p16INK4a, and WNT5A in human HPs ( hyperplastic polyps), sessile serrated adenomas/polyps (SSA/Ps), and traditional serrated adenomas (TSAs) .The distribution of Ki67 and p16INK4a positive cells in TSAs was different from that in HPs and SSA/Ps. PMID: 28627675
  39. Ki-67 expression in ureteroscopic biopsy specimens is potentially helpful in clinical decision making for patients with suspected upper urinary tract urothelial carcinoma. PMID: 28554752
  40. For patients with ER+/HER2- breast cancer, three distinct risk patterns by Ki67-LI levels were confirmed according to the 2015 St Gallen consensus. For patients with clearly low or high Ki67-LI, straightforward clinical decisions could be offered, but for patients with intermediate Ki67-LI, other factors might provide valuable information. PMID: 28061893
  41. Data suggest that Ki-67 index and survivin may be useful biomarkers for rectal cancer with preoperative chemoradiotherapy. PMID: 29491110
  42. IHC based post-Ki67 levels may have distinct predictive power compared with the naive IHC Ki67. PMID: 28412725
  43. Ten international pathology institutions participated in this study and determined messenger RNA expression levels of ERBB2, ESR1, PGR, and MKI67 in both centrally and locally extracted RNA from formalin-fixed, paraffin-embedded breast cancer specimens with the MammaTyper(R) test. Samples were measured repeatedly on different days within the local laboratories, and reproducibility was assessed by means of variance comp... PMID: 28490348
  44. Our data support Ki67 evaluation to estimate non-small-cell lung cancer (NSCLC) patients' prognosis, particularly for adenocarcinoma. PMID: 26272457
  45. p16/Ki-67 co-expressions associated strongly with high-risk human papillomavirus persistence, especially with HPV16/18, and could be considered as a suitable biomarker for cervical cancer screening PMID: 27588487
  46. high expression of VEGF and Ki-67 were independent poor prognostic factors for overall survival in adenoid cystic carcinoma PMID: 26194375
  47. Proliferative markers-mitotic count and Ki67 index-have limited value to predict recurrence or metastasis in congenital mesoblastic nephromas with a cellular component PMID: 27484189
  48. KI-67 expression correlates with SATB1 expression in non-small cell lung carcinoma. PMID: 29374696
  49. Ki-67 may be of diagnostic value in distinguishing between partial and complete hydatidiform moles PMID: 29374747
  50. Ki-67 proliferation index (P = 0.027) proved to be independent prognostic factors PMID: 27049832

Show More

Hide All

Subcellular Location
Chromosome. Nucleus. Nucleus, nucleolus.
Database Links

HGNC: 7107

OMIM: 176741

KEGG: hsa:4288

STRING: 9606.ENSP00000357643

UniGene: Hs.689823

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*