Recombinant Human Antigen KI-67(MKI67) ,partial

Code CSB-EP014597HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P46013
Relevance Thought to be required for maintaining cell proliferation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Research Area Others
Source E.coli
Gene Names MKI67
Protein Names Recommended name: Antigen KI-67
Expression Region 3120-3256aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular Location Chromosome, Nucleus, Nucleus, nucleolus
Database Links

HGNC: 7107

OMIM: 176741

KEGG: hsa:4288

STRING: 9606.ENSP00000357643

UniGene: Hs.689823

Related Products

MKI67 Antibodies

MKI67 Antibodies for Human

MKI67 Antibodies for Homo sapiens (Human)

MKI67 Antibodies for

MKI67 Proteins

MKI67 Proteins for Homo sapiens (Human)

MKI67 ELISA Kit

MKI67 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.