Recombinant Human C-C motif chemokine 19(CCL19)

Code CSB-EP859522HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q99731
Relevance May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chokine receptor CCR7. Recombinant CCL19 shows potent chotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Beta-chemokine exodus-3CK beta-11Epstein-Barr virus-induced molecule 1 ligand chemokine ;EBI1 ligand chemokine ;ELCMacrophage inflammatory protein 3 beta ;MIP-3-beta;Small-inducible cytokine A19
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Research Area Immunology
Source E.coli
Gene Names CCL19
Expression Region 22-98aa
Tag Info N-terminal GST-tagged
Mol. Weight 35.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Subcellular Location Secreted
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Database Links

HGNC: 10617

OMIM: 602227

KEGG: hsa:6363

STRING: 9606.ENSP00000308815

UniGene: Hs.50002

Pathway Chemokine signaling pathway
NF-kappa B signaling pathway

Related Products

CCL19 Antibodies

CCL19 Antibodies for Human

CCL19 Antibodies for Homo sapiens (Human)

CCL19 Proteins

CCL19 Proteins for Homo sapiens (Human)

CCL19 ELISA Kit

CCL19 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.