Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP859522HU |
Size | $1812 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | CCL19 |
Uniprot No. | Q99731 |
Research Area | Immunology |
Alternative Names |
Beta chemokine exodus 3; Beta-chemokine exodus-3; C C chemokine ligand 19; C-C motif chemokine 19; CC chemokine ligand 19; CCL 19; CCL19; CCL19_HUMAN; Chemokine (C C motif) ligand 19; Chemokine (CC motif) ligand 19; Chemokine C C Motif Ligand 19; Chemokine CC Motif Ligand 19; CK beta 11; CK beta-11; CKb 11; CKb11; EBI 1 ligand chemokine; EBI1 ligand chemokine; ELC; Epstein-Barr virus-induced molecule 1 ligand chemokine; Exodus 3; Exodus3; Macrophage inflammatory protein 3 beta; MGC34433; MIP 3 beta; MIP 3B; MIP-3-beta; MIP-3b; MIP3 beta; MIP3B; OTTHUMP00000000531; SCYA 19; SCYA19; Small inducible cytokine A19; Small inducible cytokine subfamily A (Cys Cys) member 1; Small-inducible cytokine A19
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 22-98aa |
Target Protein Sequence | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 35.8kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal GST-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Tissue Specificity | Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach. |
Database Links |
HGNC: 10617 OMIM: 602227 KEGG: hsa:6363 STRING: 9606.ENSP00000308815 UniGene: Hs.50002 |