Code | CSB-EP005065HU |
Abbreviation | Recombinant Human CDK4 protein |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The gene encoding the Human CDK4 protein (2-303aa) is incorporated into a plasmid vector to generate recombinant plasmid, which is then introduced into e.coli cells. The e.coli cells containing the recombinant plasmid are selected and cultured under conditions that stimulate the expression of the gene of interest. A N-terminal 6xHis tag is attached to the protein. After expression, affinity purification is employed to isolate and purify the recombinant Human CDK4 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human CDK4 protein, revealing a purity level exceeding 90%.
There are currently no reviews for this product.
I am looking CDK4 Human recombinant protein with His-tag (or concentration of 1mg/ml) and protein should not be denatured. .can you let us know is CSB-RP116574h meets these specs.
Is the activity determined for this protein
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE