Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)

Code CSB-EP019496HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P62877
Relevance E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets. The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, like CDC34, to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Protein ZYP RING finger protein 75 RING-box protein 1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Research Area Cell Biology
Source E.coli
Gene Names RBX1
Protein Names Recommended name: E3 ubiquitin-protein ligase RBX1 EC= 6.3.2.- Alternative name(s): Protein ZYP RING finger protein 75 RING-box protein 1 Short name= Rbx1 Regulator of cullins 1
Expression Region 1-108aa
Tag Info N-terminal GST-tagged
Mol. Weight 39.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets
Subcellular Location Cytoplasm, Nucleus
Protein Families RING-box family
Tissue Specificity Widely expressed.
Database Links

HGNC: 9928

OMIM: 603814

KEGG: hsa:9978

STRING: 9606.ENSP00000216225

UniGene: Hs.474949

Pathway HIF-1 signaling pathway
TGF-beta signaling pathway
Wnt signaling pathway
Cell cycle
Protein processing in endoplasmic reticulum
DNA repair pathway
Ubiquitin mediated proteolysis

Related Products

RBX1 Antibodies

RBX1 Antibodies for Homo sapiens (Human)

RBX1 Antibodies for Human

RBX1 Proteins

RBX1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.