Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)

Code CSB-EP019496HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names RBX1
Uniprot No. P62877
Research Area Cell Biology
Alternative Names BA554C12.1; E3 ubiquitin-protein ligase RBX1; FLJ60363; MGC13357; MGC1481; OTTHUMP00000028983; Protein ZYP; Rbx 1; Rbx1; RBX1_HUMAN; Regulator of cullins 1; Ring box 1; Ring box 1 E3 ubiquitin protein ligase; RING box protein 1; RING finger protein 75; RING finger protein; RING-box protein 1; Ringbox protein 1 ; RNF 75; RNF75; ROC 1; ROC1; ZYP protein
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-108aa
Target Protein Sequence MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.3kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets
Gene References into Functions
  1. The E3 ubiquitin ligase and RNA-binding protein ZNF598 orchestrate ribosome quality control of premature polyadenylated mRNAs. PMID: 28685749
  2. SESN2 is critical to protect cells against detrimental effect of mitochondrial damage and RBX1 is a negative regulator of SESN2 which hampers its stabilization. PMID: 29294217
  3. RBX-1 overexpression in bladder UCC is associated with high tumor grade and advanced stage and represents biological potential of invasiveness and aggressive disease. PMID: 28946546
  4. The crystal structure of a pentameric CRL2(VHL) complex, composed of Cul2, Rbx1, Elongin B, Elongin C, and pVHL reveals how Rbx1 interacts with Cullin 2. PMID: 28591624
  5. Study demonstrated that ROC1 was overexpressed in esophageal squamous cell carcinomas, which was positive associated with poor prognosis of esophageal cancer patients. PMID: 28418860
  6. p97 negatively regulates NRF2 through the canonical pathway by extracting ubiquitylated NRF2 from the KEAP1-CUL3 E3 complex. PMID: 28115426
  7. Regulation of substrate ubiquitination and polyubiquitination takes place through Rbx1 rotations. PMID: 28082425
  8. High RBX1 expression was related to poor tumor differentiation, advanced TNM stage, and lymph node metastasis in non-small cell lung cancer. PMID: 27566015
  9. Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells. PMID: 26540345
  10. ROC1 has an important role in the malignant progression of bladder transitional cell carcinoma via the mTOR/DEPTOR pathway. PMID: 26742010
  11. Nedd8(Q40E) cannot induce the same structural effect on Cul1-Rbx1 as wild-type Nedd8. PMID: 26632597
  12. RBX1 E3 ubiquitin protein expression responsible with multiple genetic mechanism in the development of head and neck cancer. PMID: 24596130
  13. This work sheds new light on the roles of NEDD8 lysines on neddylation cascades and provides a dominant negative mutant for the study of neddylation and its biological functions. PMID: 25918018
  14. These findings indicate that Rbx1 and Rbx2 can both activate Cul5-Vif E3 ligase in vitro, but they may undergo a more delicate selection mechanism in vivo. PMID: 25912140
  15. upregulation of miR-194 can inhibit proliferation, migration, and invasion of GC cells, possibly by targeting RBX1. Aberrant expression of miR-194 and RBX1 is correlated to GC patient survival time. PMID: 25412959
  16. RBX1 expression level was associated with the proliferation of gastric cancer. PMID: 24292229
  17. Studied the DNA-level mechanisms affecting KEAP1/CUL3/RBX1 E3-ubiquitin ligase complex as a regulator of NRF2 levels in ovarian cancer. PMID: 25114896
  18. eEF1A1 may mediate SAMHD1 turnover by targeting it to the proteosome for degradation through association with Cullin4A and Rbx1. PMID: 25423367
  19. data suggest a new paradigm for Hsp90-modulated assembly of a Cul3/DBC2 E3 ubiquitin ligase complex that may extend to other E3 ligase complexes. PMID: 24608665
  20. CUL4A-DDB1-Rbx1 E3 ligase controls the quality of the PTS2 receptor Pex7p. PMID: 24989250
  21. A genome-wide association study on a southern European population identified a new Crohn's disease susceptibility locus at RBX1-EP300. PMID: 22936669
  22. Overexpression of RBX1 protein contributes to tumor progression and poor prognosis of non-muscle-invasive bladder cancer (NMIBC). PMID: 23609182
  23. ROC1 knockdown significantly inhibited the growth of liver cancer cells by sequentially and independently inducing autophagy and p21-dependent cell senescence. PMID: 22935614
  24. a model by which N-terminal cleavage of RBX1 impairs its activity and promotes susceptibility to ER stress induction. PMID: 22822056
  25. Structural and biochemical analyses reveal that GLMN adopts a HEAT-like repeat fold that tightly binds the E2-interacting surface of RBX1, inhibiting CRL-mediated chain formation by the E2 CDC34. PMID: 22748924
  26. Numb regulates glioma stem cell fate and growth by altering epidermal growth factor receptor and Skp1-Cullin-F-box ubiquitin ligase activity PMID: 22553175
  27. Glomulin binds Rbx1 and regulates cullin-1 RING ligase-mediated turnover of Fbw7. PMID: 22405651
  28. the SCF complex (Skp1/Cul1/F-box protein/Roc1) intervenes in the surveillance of Cdh1 cellular abundance in S-phase PMID: 16123585
  29. Results indicate that FBW5-DDB1-CUL4-ROC1 is an E3 ubiquitin ligase regulating TSC2 protein stability and TSC complex turnover. PMID: 18381890
  30. Data show that REDD1 is subject to ubiquitin-mediated degradation mediated by the CUL4A-DDB1-ROC1-beta-TRCP E3 ligase complex and through the activity of glycogen synthase kinase 3beta. PMID: 19557001
  31. KLHL20-Cul3-ROC1 is an E3 ligase for DAPK ubiquitination PMID: 20389280
  32. A new conformation of RBX1 involved in the e2-to-substrate ubiquitin-like protein transfer is discussed. PMID: 21765416
  33. ROC1 expression is negatively correlated with cyclin D1 expression, demonstrating its importance in the degradation of cyclin D1 in melanomas. PMID: 21300445
  34. in human cancer cells, RBX1 silencing causes the accumulation of DNA replication licensing proteins CDT1 and ORC1, leading to DNA double-strand breaks, DDR, G(2) arrest, and, eventually, aneuploidy PMID: 21115485
  35. Data show that CRN7 interacted with Cullin1 and Roc1 to form a novel SCF-like E3 complex. PMID: 21130766
  36. Nrf2 regulates Cul3-Rbx1 by controlling regulation of expression and induction of Cul3-Rbx1 PMID: 20452971
  37. The data suggest that RBX1 could potentially be developed into biomarkers of resistance to acyl sulfonamide-based cancer drugs. This will require clinical validation in a series of patients treated with R3200. PMID: 19723642
  38. crystal structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF complex PMID: 11961546
  39. findings report that HIV-1 Vif interacts with cellular proteins Cul5, elongins B and C, and Rbx1 to form an Skp1-cullin-F-box (SCF)-like complex PMID: 14564014
  40. DET1 promotes ubiquitination and degradation of c-Jun by assembling a multisubunit ubiquitin ligase containing DNA Damage Binding Protein-1 (DDB1), cullin 4A (CUL4A), Regulator of Cullins-1 (ROC1), and constitutively photomorphogenic-1 PMID: 14739464
  41. Keap1 negatively regulates Nrf2 function in part by targeting Nrf2 for ubiquitination by the CUL3-ROC1 ligase and subsequent degradation by the proteasome PMID: 15601839
  42. This study uncovers CUL4-DDB-ROC1 as a histone ubiquitin ligase and demonstrate that histone H3 and H4 ubiquitylation participates in the cellular response to DNA damage. PMID: 16678110
  43. ROC1 protein binds to the proinactive form of pro-caspase 3 and shortens the half life of the enzyme. PMID: 17217622
  44. VprBP depletion abolished the in vivo interaction of Merlin and Roc1-Cullin4A-DDB1, which resulted in Merlin stabilization and inhibited ERK and Rac activation PMID: 18332868
  45. CUL1 ECTD (extreme C-terminal domain; spanning the C-terminal 50 amino acids), did not contribute to CUL1's stable association with ROC1. PMID: 18723677
  46. SCCRO recruits Ubc12 approximately NEDD8 to the CAND1-Cul1-ROC1 complex but that this is not sufficient to dissociate or overcome the inhibitory effects of CAND1 on cullin neddylation PMID: 18826954
  47. ROC1 silencing triggers multiple death and growth arrest pathways to effectively suppress tumor cell growth, suggesting that ROC1 may serve as a potential anticancer target PMID: 19509229

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus
Protein Families RING-box family
Tissue Specificity Widely expressed.
Database Links

HGNC: 9928

OMIM: 603814

KEGG: hsa:9978

STRING: 9606.ENSP00000216225

UniGene: Hs.474949

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1