Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
ALPS4; AV095280; GTPase NRas; HRAS1; N ras; N ras protein part 4; Neuroblastoma RAS viral (v ras) oncogene homolog; NRAS; NRAS1; NS6; OTTHUMP00000013879; OTTMUSP00000023521; RASN_HUMAN; Transforming protein N Ras; Transforming protein N-Ras; v ras neuroblastoma RAS viral oncogene homolog
Species
Homo sapiens (Human)
Expression Region
1-186aa
Target Protein Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human NRAS contains amino acids 1-186. This NRAS protein is theoretically predicted to have a molecular weight of 56.1 kDa. This NRAS protein is produced using e.coli expression system. The NRAS gene fragment has been modified by fusing the N-terminal 10xHis-GST tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant NRAS protein during the following stages.
The human GTPase NRAS, a member of the Ras family, is a small GTP-binding protein that plays a crucial role in cell signaling and regulation of cell growth and differentiation. NRAS acts as a molecular switch, cycling between an active GTP-bound state and an inactive GDP-bound state. Upon activation by extracellular signals, such as growth factors, NRAS triggers downstream signaling cascades, including the MAPK pathway, which regulates various cellular processes like proliferation and differentiation. Dysregulation or mutations in NRAS are implicated in various cancers and genetic disorders. Understanding the intricate signaling mechanisms involving NRAS provides insights into normal cellular physiology and contributes to targeted therapeutic strategies in cancer research.