Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP888008HUb1 |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | Q9H9S0 |
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV |
| Research Area | Cancer |
| Source | E.coli |
| Gene Names | NANOG |
| Expression Region | 1-305aa |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Mol. Weight | 39.6 kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. Binds to the POU5F1/OCT4 promoter |
| Subcellular Location | Nucleus |
| Protein Families | Nanog homeobox family |
| Tissue Specificity | Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and |
| Database Links |
HGNC: 20857 OMIM: 607937 KEGG: hsa:79923 STRING: 9606.ENSP00000229307 UniGene: Hs.635882 |
| Pathway | Signaling pathways regulating pluripotency of stem cells |
NANOG Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA015424GA01HU | NANOG Antibody | Human | ELISA,WB,IF |
NANOG Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-MA888008A0m | NANOG Monoclonal Antibody | Human, Mouse, Rat | ELISA, WB, ICC, IF, FC |
| CSB-PA888008LA01HU | NANOG Antibody | Human | ELISA, WB, IHC |
| CSB-PA888008LC01HU | NANOG Antibody, FITC conjugated | Human | ELISA |
| CSB-PA888008LB01HU | NANOG Antibody, HRP conjugated | Human | ELISA |
| CSB-PA888008LD01HU | NANOG Antibody, Biotin conjugated | Human | ELISA |
NANOG Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP888008HU | Recombinant Human Homeobox protein NANOG(NANOG) | E.coli |
| CSB-YP888008HU | Recombinant Human Homeobox protein NANOG(NANOG) | Yeast |
| CSB-BP888008HU CSB-MP888008HU |
Recombinant Human Homeobox protein NANOG(NANOG) | Baculovirus Mammalian cell |
NANOG ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL015424HU | Human Homeobox protein NANOG(NANOG) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 6.25 pg/mL |
Recombinant Rat Frataxin, mitochondrial(Fxn)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Rab-11A(RAB11A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Alpha-2-macroglobulin(A2m),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Molybdopterin synthase catalytic subunit(MOCS2)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.