Recombinant Human Insulin receptor(INSR),Partial

In Stock
Code CSB-EP011753HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names INSR
Uniprot No. P06213
Research Area Signal Transduction
Alternative Names CD220; HHF5; human insulin receptor; Insr; INSR_HUMAN; Insulin receptor subunit beta; IR 1; IR; IR-1 ; IR1
Species Homo sapiens (Human)
Source E.coli
Expression Region 1023-1298aa
Target Protein Sequence ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 47.2kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosine residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways
Gene References into Functions
  1. The structural refinement of the antagonist once conjugated to insulin provided a set of partial agonists exhibiting between 25 and 70% of the maximal agonism of native insulin at the two insulin receptor isoforms, with only slight differences in inherent potency PMID: 29412818
  2. Cav-2beta isoform yielded by alternative translation initiation desensitizes insulin receptor (IR) via dephosphorylation by PTP1B, and subsequent endocytosis and lysosomal degradation of IR, causing insulin resistance. PMID: 29604334
  3. They retained the main IGF-1R-related properties, but the hormones with His49 in IGF-1 and His48 in IGF-2 showed significantly higher affinities for IR-A and for IR-B, being the strongest IGF-1- and IGF-2-like binders of these receptors ever reported. PMID: 29608283
  4. MARCH1 ubiquitinates INSR to decrease cell surface INSR levels, but unlike other INSR ubiquitin ligases, MARCH1 acts in the basal state rather than after insulin stimulation. PMID: 27577745
  5. we aim to provide an overview of the physiological and pathophysiological roles of the IR within metabolic syndrome and its related pathologies, including cardiovascular health, gut microflora composition, gastrointestinal tract functioning, polycystic ovarian syndrome, pancreatic cancer, and neurodegenerative disorders PMID: 29462993
  6. In vitro results show that glycation of INSR decreases insulin binding under hyperglycemic conditions suggesting this mechanism may provide a mechanism by which INS resistance develops in diabetes. PMID: 29207492
  7. Circulating pri-miRNA-944 and 3662 can improve non-invasive non-small cell lung cancer detection of operable stages of SCC and AC PMID: 28964576
  8. current data demonstrate that both INSR and IGF1R are directly targeted by C-myc and exert similar effects to promote the tumorigenesis and metastasis of TSCC through the NF-kappaB pathway. PMID: 29518496
  9. the mechanism by which insulin induces IR translocation to the cell nucleus, was examined. PMID: 29317261
  10. We conclude that the crosstalk between angiotensin AT1 receptor and insulin receptor signaling shows a high degree of specificity, and involves Galphaq protein, and activation of distinct kinases. Thus, the BRET(2) technique can be used as a platform for studying molecular mechanisms of crosstalk between insulin receptor and 7TM receptors. PMID: 28854843
  11. INSR rs1051690 SNP is associated with increased risk of gastric cancer, while polymorphisms in IL12B, CCND1 and IL10 genes are not linked with the presence of gastric cancer PMID: 28596683
  12. Findings demonstrate that, in human breast cancer cells, DDR1 regulates IR expression and ligand dependent biological actions. This novel functional crosstalk is likely clinically relevant. PMID: 28591735
  13. in beta cells, INSR-B has a protective role, while INSR-A expression sensitizes beta cells to programmed cell death. PMID: 27526875
  14. These results support the hypothesis that INSR gene expression in different areas of Alzheimer's patient's brains. PMID: 28164769
  15. In endocrine-sensitive breast cancer cells, insulin was not growth stimulatory, likely due to the presence of hybrid InsR/IGF1R, which has high affinity for IGF-I, but not insulin. Combination inhibition of InsR and IGF1R showed complete suppression of the system in endocrine-sensitive breast cancer cells PMID: 28468775
  16. Report complex relationships between individual tumor-specific expression of IGF1R/pIGF1R and InsR/pInsR, response endocrine treatment and breast cancer prognosis. PMID: 28030849
  17. analysis of compounds that cause IGF-1Rbeta but not Insulin Receptor degradation specifically in tumor cells with no effects seen in normal diploid fibroblasts PMID: 27384680
  18. The gained results are observed not only the unbinding mechanism of IRK-PTP1B complexes came from pulling force profile, number of hydrogen bonds, and interaction energy between IRK and PTP1Bs but also described PTP1B's point mutations could variably change its binding affinity towards IRK. PMID: 28707052
  19. The data in this paper demonstrate that IR knockdown in primary tumors partially reverses the growth-promoting effects of hyperinsulinemia as well as highlighting the importance of the insulin receptor signaling pathway in cancer progression, and more specifically in epithelial-mesenchymal transition. PMID: 27435064
  20. INSR rs2252673 and rs3745546 polymorphisms were associated with sensitivity to platinum-based chemotherapy in epithelial ovarian cancer patients and rs2252673 polymorphism may be an independent risk factor for EOC prognosis. PMID: 28436941
  21. The IGF1R purified in n-dodecyl-beta-D-maltoside showed ligand-stimulated autophosphorylation and kinase activity, suggesting an intact transmembrane signaling mechanism. PMID: 28830678
  22. Signaling via the insulin (INS) and insulin-like growth factor 1 (IGF1) receptors (INSR and IGF1R) regulate basal cell (BC) differentiation into ciliated cells. PMID: 28050756
  23. High INSR expression is associated with drug Resistance in Gastrointestinal Stromal Tumors. PMID: 28760855
  24. the above data indicate a direct role for IR expression as a determinant of PT-gluconeogenesis. Thus reduced insulin signaling of the proximal tubule may contribute to hyperglycemia in the metabolic syndrome via elevated gluconeogenesis. PMID: 27322100
  25. Activation of D4 receptor inhibits insulin receptor expression in RPT cells from WKY rats. The aberrant inhibition of D4 receptor on insulin receptor expression and effect might be involved in the pathogenesis of essential hypertension. PMID: 27107134
  26. The HIR MAb binds the insulin receptor on the BBB. PMID: 28279069
  27. data indicate that post-receptor signalling abnormalities might contribute to Myotonic dystrophy insulin resistance regardless the alteration of INSR splicing. PMID: 28915272
  28. We identified vascular INSR expression as a potential biomarker for progression in bladder cancer. The data suggest that IGF-2/INSR mediated paracrine crosstalk between bladder cancer cells and endothelial cells is functionally involved in tumour angiogenesis and may thus represent a new therapeutic target. PMID: 28295307
  29. The INSR rs2059806 SNP is associated with pre-eclampsia phenotypes in two independent cohorts suggesting that genetic susceptibility may be implicated in the link between pre-eclampsia and subsequent vascular and metabolic diseases. PMID: 28117222
  30. IGF2 and insulin receptor A are important for uterine leiomyoma stem cell proliferation and may represent paracrine signaling between leiomyoma cell types. PMID: 28324020
  31. Disruption of insulin receptor function inhibits proliferation in endocrine-resistant breast cancer cells PMID: 26876199
  32. Differential IR isoform expression suggests a distinct role for each in endometrial physiology and cancer. PMID: 27088794
  33. Results show that IR expression level in renal cell carcinoma tissue was significantly lower in patients with tumor stage pT2-4 and/or distant metastases. PMID: 28393204
  34. Findings suggest that the induction of microRNA miR-1271 by saturated fatty acid palmitate promotes the development of insulin resistance by targeting insulin receptor (INSR) and insulin receptor substrate 1 protein (IRS-1) in hepatocytes. PMID: 27613089
  35. Study reveals an important function of CHIP-mediated proteolysis in insulin and IGF1 signaling; upon proteotoxic stress conditions and during aging, CHIP is recruited toward disposal of misfolded proteins, reducing its capacity to degrade the INSR; identify a degradation pathway that controls the level of active DAF-2/INSR in C. elegans, Drosophila and human cells. PMID: 28431247
  36. EGF and insulin receptor tyrosine kinase exemplify how receptor location is coupled to signal transduction. (Review) PMID: 27023845
  37. a straightforward protocol for production of recombinant IGF-II and prepared six IGF-II analogs with IGF-I-like mutations. All modified molecules exhibit significantly reduced affinity toward IR-A, particularly the analogs with a Pro-Gln insertion in the C-domain. Moreover, one of the analogs has enhanced binding affinity for IGF-1R due to a synergistic effect of the Pro-Gln insertion and S29N point mutation. PMID: 27510031
  38. Conus geographus G1 (Con-Ins G1), is the smallest known insulin found in nature and lacks the C-terminal segment of the B chain that, in human insulin, mediates engagement of the insulin receptor and assembly of the hormone's hexameric storage form. This study found that Con-Ins G1 is monomeric, strongly binds the human insulin receptor and activates receptor signaling. PMID: 27617429
  39. Mutations of the INSR gene is associated with acanthosis nigricans and hyperandrogenism. PMID: 27505086
  40. Identification of a Novel Homozygous INSR Variant in a Patient with Rabson-Mendenhall Syndrome from the United Arab Emirates. PMID: 27326825
  41. Findings suggest that insulin receptor substrate -1 Gly972Arg polymorphism is associated with polycystic ovary syndrome in the Caucasian ethnicity, and insulin receptor substrate -2 Gly1057Asp polymorphism is correlated with polycystic ovary syndrome in the Asian ethnicity. However, insulin receptor His 1058 C/T polymorphism may not be implicated in polycystic ovary syndrome. PMID: 27098445
  42. Two miR-binding SNPs SLC30A8 rs2466293 and INSR rs1366600 increased Gestational diabetes mellitus susceptibility. Functional studies were required to confirm the underlying mechanism. PMID: 28190110
  43. The data demonstrate that insulin, IGF1 and IGF2 elicit different insulin receptor phosphorylation kinetics and potencies that translate to downstream signaling. PMID: 27155325
  44. Suggest a novel role of miR-503 as a regulator of vascular smooth muscle cell proliferation and migration by modulating INSR. PMID: 27829550
  45. In silico characterization of nsSNPs affecting INSR gene function can aid in better understanding of genetic differences in disease susceptibility. PMID: 27840822
  46. The INSR gene is potentially associated with eating difficulties in preterm infants. PMID: 26629831
  47. four compounds demonstrated considerably increased binding affinity towards IR and less toxicity compared with parent compounds. Finally, molecular interaction analysis revealed that six parent compounds and four analogues interact with the active site amino acids of IR PMID: 27034931
  48. Study describes a revised structure of the human insulin receptor ectodomain revealing new features within the receptor insert domain and corrects errors in the first and third fibronectin type III domains. The new structure allows improved resolution of the insert domain, a critical element to ligand binding and signal transduction. PMID: 26853939
  49. C1008T SNP at exon 17 of INSR is associated with insulin resistance in Indian women with polycystic ovarian syndrome. PMID: 26721804
  50. A novel insertion/deletion (indel) mutation was found in INSR gene. PMID: 26874853
  51. mTORC2 promotes rapamycin- and ligand-induced type I insulin-like growth factor receptor / insulin receptor phosphorylation. PMID: 26584640
  52. Study provides evidence that IR, irrespective of isoform type, mediates primary resistance to IGF-IR-targeted therapy and can be used as a potential biomarker for patient selection. PMID: 26263910
  53. remarkable therapeutic window observed for BI 885578 is achieved by virtue of the distinctive pharmacokinetic properties of the compound capitalizing on the physiologic mechanism of glucose homeostasis and differential levels of IGF1R and INSR expression PMID: 26438154
  54. Given the limited number of patients treated with KW-2450 in our study, it is not possible to make a meaningful comparison of efficacy with other IGF-1R/IR dual kinases inhibitors PMID: 26850678
  55. Data indicate that a highly specific qRT-PCR assay to quantify levels of the insulin-like growth factor receptor and insulin receptor isoforms (IR-A, IR-B, and IGF-1R) on the same scale to provide a critical diagnostic and predictive tool. PMID: 26862994
  56. Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells. PMID: 26760116
  57. The results demonstrate an increased IR-A:IR-B ratio in all clinical stages of breast cancer PMID: 26406954
  58. The INSR rs2059806 SNP is associated with small for gestational age pregnancies. PMID: 26089371
  59. INSR (rs1799816) polymorphism conferred risk towards T2D in Brahmins. PMID: 26251103
  60. novel nonsense mutations are associated with reduced expression of the mature INSR beta-subunit, which was most likely due to impaired proreceptor processing PMID: 26160152
  61. results indicate a significant correlation between T132903C and C109869T single nucleotide polymorphisms in the insulin receptor and solute carrier family 6 member 14 amino acid transporter (SLC6A14) genes with idiopathic infertility in Persian males PMID: 27172637
  62. Non-small cell lung cancer cell survival crucially depends on functional insulin receptors PMID: 26113601
  63. Three SNPs of the INSR, rs2059807, s8109559 and rs919275, were significantly associated with obesity-related cancers (p value < 0.02) with the most significantly associated SNP being rs2059807 (p value = 0.008). PMID: 26077721
  64. A disease entity of adult-onset hyperinsulinemic hypoglycemia syndrome associated with mutations in INSR gene. PMID: 25753915
  65. rs2059806 of INSR was associated with both type 2 diabetes mellitus and type 2 diabetic nephropathy, while rs7212142 of mTOR was associated with type 2 diabetic nephropathy but not type 2 diabetes mellitus in a Chinese Han population. PMID: 25867326
  66. The insulin receptor and IGF1 receptor kinase domains are functional dimers in the activated state. PMID: 25758790
  67. It is reported here that both splice variants of insulin/IGF1 receptor hybrids are activated by IGF1 with >20-fold higher potency than insulin. PMID: 25604425
  68. Data revitalizes the role of the INSR isoforms in the pathogenesis of type 2 diabetes mellitus, and suggests that an abrogated INSRB:A ratio that favors the INSRA isoform may negatively impact insulin-mediated metabolic signalling. PMID: 25742416
  69. Results suggest INSR CT or TT genotype carriers have an increased risk for developing refractory temporal lobe epilepsy PMID: 25458098
  70. The rs2059807 could be a promising candidate SNP that might be involved in the development of Polycystic ovary syndrome. PMID: 25622255
  71. Insulin receptor (IR) signaling and endocytosis are regulated by AMPK,enzyme of purine de novo synthesis pathway ATIC,putative tyrosine phosphatase PTPLAD1. IR/PTPLAD1/ATIC/AMPK form a complex within the plasma membrane and Golgi/endosome.ATIC deletion increases AMPK-Thr172 phosphorylation.Both ATIC and PTPLAD1 affect IR tyrosine phosphorylation.With AICAR, they regulate insulin mediated translocation of Glut2 in HEK 293. PMID: 25687571
  72. found significant associations between other variants of the INSR gene and colorectal cancer risk PMID: 25557790
  73. Our work provides evidence supporting a link between IGFIR and IR isoform expression levels and colorectal adenoma risk. PMID: 25017244
  74. MET, HER3, IGF1R, and INSR pathways activation represent novel mechanism underlying lapatinib unresponsiveness in HER2+ gastric cancer. Combination strategy may be recommended in treating patients with HER2+ gastric cancer with these pathways activation PMID: 24973425
  75. Protective effects of breastfeeding are reflected in higher expression levels of SLC27A2, FASN, PPARalpha and INSR in blood cells. PMID: 24277691
  76. Data indicate that engineered ubiquitin ligase is an effective therapeutic strategy for the treatment of the cancers with co-expressed insulin receptor/insulin-like growth factor receptor (IR/IGF-1R). PMID: 24970814
  77. Grb14-insulin receptor interaction is regulated in part by GSK-3 activity. PMID: 24535599
  78. studied whether the reversal of gestational diabetes mellitus effects on transport by insulin depends on restoration of insulin receptor-A expression PMID: 25351985
  79. Overexpression of INSR increased cell proliferation, colony formation, migration, invasion and resistance to apoptosis in prostate cancer. PMID: 24809298
  80. Determining the amount of phosphorylated insulin receptor could thus represent a novel prognostic/predictive tool in colorectal adenocarcinoma patients. PMID: 25102778
  81. CUL7, OBSL1 and CCDC8 modulate the alternative splicing of the INSR PMID: 24711643
  82. INSR (rs1052371) was not associated with colorectal cancer risk in an Iranian cohort. PMID: 24175768
  83. A novel heterozygous mutation of the insulin receptor gene (INSR) was identified in this family with with type A insulin resistance syndrome PMID: 24468607
  84. Insulin-induced phosphorylation of the insulin receptor is dependent on Neu1 sialidase activity. PMID: 24583283
  85. These results show that IR can be activated through a pathway that bypasses its canonical ligand-binding domain. PMID: 24867955
  86. Data indicate that changes in tyrosine phosphorylation of insulin receptor (InsR) are associated with insulin resistance (IR) in patients with gestational diabetes mellitus (GDM) PMID: 24939305
  87. Data indicate that insulin receptor isoformA (IR-A) mRNA was differentially expressed in four endometrial carcinoma cell lines. PMID: 23950881
  88. The impact of insulin on different cell types in the intestinal epithelium might differ depending on relative IR-B IR-A expression levels. PMID: 24127567
  89. study concluded that the His 1058 C/T polymorphism at the tyrosine kinase domain of the INSR gene had a relationship to the pathogenesis of lean polycystic ovary syndrome patients in a Japanese population PMID: 24568043
  90. Findings show that in vitro model could be useful for determining the molecular mechanism underlying insulin receptor (IR) cleavage. PMID: 24508798
  91. Case Report: loss of NPC1 function, with attendant changes in membrane cholesterol composition, does not significantly modify the insulin resistance phenotype, even in the context of severely impaired INSR function. PMID: 20521171
  92. Data suggest that the distinct fiber type involvement in DM1 and DM2 muscle tissues would not be related to qualitative differences in the expression of insulin receptor gene (INSR). PMID: 23666741
  93. LMBD1 plays an imperative role in mediating and regulating the endocytosis of the IR. PMID: 24078630
  94. INSR rs1366600, ACSL1 rs2292899 and FABP2 rs11724758 could influence the susceptibility to type 2 diabetes in Chinese Han population, most likely through their effects on the specific miRNA-binding sites. PMID: 23303383
  95. Indinavir and nelfinavir inhibit proximal insulin receptor signaling and salicylate abrogates inhibition: potential role of the NFkappa B pathway PMID: 23386514
  96. the LRP6(R611C) mutation diminishes TCF7L2-dependent transcription of the IR while it increases the stability of IGFR and enhances mTORC1 activity. PMID: 23395167
  97. A mechanism responsible for the generation of mitogenic IR-A via a novel interplay between IR and EGFR pathways in hepatocellular carcinoma. PMID: 23633480
  98. study reports that expression of the insulin receptor in kidney is altered during diabetes; a strong expression in proximal and distal tubules from renal cortex, and a significant reduction in type 2 diabetic patients was detected PMID: 23059533
  99. Results of this study demonstrated the dependence of INSR and related to insulin receptor signaling gene expressions in U87 glioma cells on ERN1 enzyme function indicating its participation in the regulation of metabolic and proliferative processes via endoplasmic reticulum stress which is important component of tumor growth and metabolic diseases. PMID: 23363253
  100. Insulin receptor isoform A to B ratio was significantly higher in cancer as well as in tumor adjacent benign prostate tissue compared to purely benign prostates PMID: 23251408

Show More

Hide All

Involvement in disease Rabson-Mendenhall syndrome (RMS); Leprechaunism (LEPRCH); Diabetes mellitus, non-insulin-dependent (NIDDM); Familial hyperinsulinemic hypoglycemia 5 (HHF5); Insulin-resistant diabetes mellitus with acanthosis nigricans type A (IRAN type A)
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Tissue Specificity Isoform Long and isoform Short are predominantly expressed in tissue targets of insulin metabolic effects: liver, adipose tissue and skeletal muscle but are also expressed in the peripheral nerve, kidney, pulmonary alveoli, pancreatic acini, placenta vasc
Database Links

HGNC: 6091

OMIM: 125853

KEGG: hsa:3643

STRING: 9606.ENSP00000303830

UniGene: Hs.465744

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1