Recombinant Human Interleukin-1 alpha(IL1A)

Code CSB-YP011613HUc7
Product Type Recombinant Protein
Size US$2010
Uniprot No. P01583
Relevance Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Research Area Immunology
Source Yeast
Gene Names IL1A
Protein Names Hematopoietin-1 IL1F1
Expression Region 113-271aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 20.0 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

HGNC: 5991

OMIM: 147760

KEGG: hsa:3552

STRING: 9606.ENSP00000263339

UniGene: Hs.1722

Pathway MAPK signaling pathway
Cellular senescence
Necroptosis
Hematopoietic cell lineage
Osteoclast differentiation
AGE-RAGE signaling pathway in diabetic complications

Related Products

IL1A Antibodies

IL1A Antibodies for Homo sapiens (Human)

IL1A Proteins

IL1A Proteins for Homo sapiens (Human)

IL1A ELISA Kit

IL1A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.