Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IL1A

Uniprot No.

P01583

Research Area

Immunology

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

113-271aa

Target Protein Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

20.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 5°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene coding for the human IL1A protein (113-271aa) was co-cloned into a plasmid vector with the N-terminal 6xHis-tag gene and then introduced into yeast cells for protein expression. After that, the cultured yeast cells are lysed to release the expressed IL1A proteins, which are purified through affinity chromatography. The purity of the recombinant human IL1A protein is over 90% as measured by SDS-PAGE.

The human IL1A protein is a proinflammatory cytokine belonging to the interleukin-1 family, along with IL1B and IL1RN. IL1A participates in various biological processes, including immune responses, inflammation, and cell proliferation. It exerts pleiotropic effects on host reactions and regulates cell functions in both positive and negative ways [1]. IL1A can induce the expression of senescence-associated secretory phenotype (SASP) components [2] and is implicated in inflammatory responses in different tissues, such as the ovarian surface epithelial cells [3].

IL1A plays a crucial role in various diseases and conditions. It has been associated with cancer, where its polymorphisms have been linked to breast cancer risk [5] and its expression can impact survival and recurrence in non-small cell lung cancer patients [4]. IL1A gene polymorphisms have been studied for their association with aggressive periodontitis in periodontal diseases [6].

References:
[1] K. Eislmayr, A. Bestehorn, L. Morelli, M. Borroni, L. Walle, M. Lamkanfiet al., Nonredundancy of il-1α and il-1β is defined by distinct regulation of tissues orchestrating resistance versus tolerance to infection, Science Advances, vol. 8, no. 9, 2022. https://doi.org/10.1126/sciadv.abj7293
[2] M. Montes, M. Lubas, F. Arendrup, B. Mentz, N. Rohatgi, S. Tumaset al., The lncrna mir31hg regulates the senescence associated secretory phenotype,, 2020. https://doi.org/10.21203/rs.3.rs-57840/v1
[3] G. Papacleovoulou, H. Critchley, S. Hillier, & J. Mason, Il1α and il4 signalling in human ovarian surface epithelial cells, Journal of Endocrinology, vol. 211, no. 3, p. 273-283, 2011. https://doi.org/10.1530/joe-11-0081
[4] N. Woods, A. Monteiro, Z. Thompson, E. Amankwah, N. Naas, E. Hauraet al., Interleukin polymorphisms associated with overall survival, disease‐free survival, and recurrence in non‐small cell lung cancer patients, Molecular Carcinogenesis, vol. 54, no. S1, 2015. https://doi.org/10.1002/mc.22275
[5] H. Baradaran-Rahimi, M. Radvar, H. Arab, J. Tavakol-Afshari, & A. Ebadian, Association of interleukin‐1 receptor antagonist gene polymorphisms with generalized aggressive periodontitis in an iranian population, Journal of Periodontology, vol. 81, no. 9, p. 1342-1346, 2010. https://doi.org/10.1902/jop.2010.100073
[6] K. Kim, J. Noh, M. Bodogai, J. Martindale, P. Pandey, X. Yanget al., Scamp4 enhances the senescent cell secretome, Genes & Development, vol. 32, no. 13-14, p. 909-914, 2018. https://doi.org/10.1101/gad.313270.118

Related Products

Target Background

Function

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Gene References into Functions

Based on the available data, C/T genotype of the rs1800587 polymorphism within IL1A gene may be associated with an increased Graves' disease risk. PMID: 29879187
IL-1 was positively related with increased BMI overweight and obesity PMID: 30070872
IL-1alpha is detectable in the majority of patients with infrarenal abdominal aortic aneurysms. PMID: 29456054
Meta-analysis suggests that the IL-1B rs16944 polymorphism is a susceptibility risk factor for febrile seizures in Caucasian and Asian populations. The IL-1B rs1143627, IL-1B rs1143634, and IL-1A rs1800587 polymorphisms are not associated with febrile seizure risk. PMID: 29808330
The IL-1b+3954 C/T polymorphism significantly increases RAS risk. In addition, the IL-10-1082 G/A polymorphism provided protective effects for RAS in the Asian population PMID: 29641282
The single nucleotide polymorphism (SNP) of IL-1beta gene (rs3917356G>A) increased the risk of HCC in the recessive model (p<0.001, OR=2.58, 95% CI=1.53-4.33), whereas other SNPs in IL-1alpha and IL-1RA showed no significant association between Hepatocellular carcinoma patients and controls. PMID: 29802240
our findings proposed an association between IL1A 4-bp ins/del polymorphism and risk of prostate cancer PMID: 29023981
effect of IL-22 on Intestinal Epithelial Cells responses may not be in inducing CXCL8 by itself, but in enhancing TNF-alpha- and IL-1-induced CXCL8 secretion to augment the contribution of IECs to local inflammatory responses. PMID: 28656529
Our pilot study demonstrated a correlation between the individual genetic inflammatory profile and the efficacy of the platelet rich plasma treatment in males PMID: 29228441
the present study was intended to determine whether single-nucleotide polymorphisms (SNPs) in the IL-1 gene cluster are also associated with periodontal disease in a Linkage disequilibrium analysis PMID: 29577711
No significant difference was seen in mRNA levels among different promoter genotype for IL1A in SCA3 patients vs. controls, except a previously reported higher level in those with the IL1A*T allele. These patients also showed an earlier age of onset than those homozygous for IL1A*C. PMID: 27246313
Obesity was associated with higher expression of NILCO molecules (Notch-IL1-leptin) in type II endometrial cancer. PMID: 28659656
This meta-analysis with 2,174 patients with chronic periodontitis and 1, 756 controls evidenced the -889 C/T polymorphism is associated to risk of development of chronic periodontitis with no significant value to heterogeneity to allelic evaluation PMID: 27918732
through IL-1alpha production, airway epithelial cells induce a pro-inflammatory lung fibroblast phenotype that is further enhanced with cigarette smoke extract exposure in COPD, suggesting an aberrant epithelial-fibroblast interaction in COPD PMID: 27418555
our study has described the association between rs3783550 (IL-1A), rs3783546 (IL-1A) and rs2853550 (IL-1B) and AS risk and between a new haplotype, "TCG", of rs3783550, rs3783546 and rs2853550 and AS in Chinese Han population. PMID: 28423679
Unicystic Ameloblastoma patients with high IL-1alpha expression in the lesion responded better to marsupialization than those in whom the expression of the protein was low, and therefore show a greater reduction of the cystic space after marsupialization. PMID: 29419674
In conclusion, the analyzed IL1A -889 C>T, IL1B +3954 C>T, and IL6 -174 G>C polymorphisms may be associated with the occurrence and development of human cytomegalovirus infection among studied patients. PMID: 28151075
Lipid apheresis suppresses the expression of IL-1alpha, IL-6 and TNF-alpha mRNA in patients with dyslipidaemias. PMID: 29096839
results suggest a role for prostatic expression of TGF-B, IL-1a, TGFBRI and TGFBRII as prognostic markers for prostate cancer. The rational combination of novel agents directed toward the inactivation of TGF-B, IL-1a, TGFBRI and TGFBRII could disrupt complementary tumor cell proliferation pathways. PMID: 27527810
There were no significant differences in GE area of infertile and fertile women. C-C motif chemokine 11 (P=0.048), TGFalpha (P=0.049), IFNgamma (P=0.033) and interleukin-1 alpha (P=0.047) were significantly elevated in uterine lavage from infertile women <35years compared to fertile but not in women 35years PMID: 27525354
The authors' findings suggest that IL-1a rs3783553 polymorphism may modulate the risk of squamous cell carcinoma of the oropharynx recurrence in patients, particularly for patients with HPV16-positive tumors. PMID: 27121322
IL-1alpha released from necrotic corneal epithelial cells may trigger inflammatory responses at the ocular surface, including cytokine production and barrier disruption. PMID: 28725984
Based on current meta-analysis, we indicated that there is lack of association between the three SNPs of IL-1 and primary open-angle glaucoma. PMID: 29179746
results showed that IL-1A -889C/T (rs1800587) was associated with systemic sclerosis susceptibility in the Chinese population PMID: 27098064
Reconstitution of ST2 (IL-1R4) specific for IL-33 activity; no suppression by IL-1Ra though a common chain IL-1R3 (IL-1RAcP) shared with IL-1. PMID: 27031441
A SNP in IL1A were associated with keratoconus in Chinese Han patients PMID: 26200829
these findings highlight the interaction between IL-6 and IL-1alpha to generate an inflammatory microenvironment in driving (PSMA,PSA) prostate clones PMID: 27451139
MSCs primed with IL-1alpha or IL-1beta showed increased secretion of G-CSF, which was blocked by IL-1Ra. PMID: 28412968
rs3783553 ins/ins genotype may increase the susceptibility to ischemic stroke, possibly by interrupting the binding site of miR-122 and miR-378 PMID: 29145255
The abnormalities in hormonal/biochemical parameters detected in Turkish polycystic ovary syndrome patients may be related with IL-6 gene polymorphism rather than IL-1A. PMID: 28019133
Major D allele of IL-1A (I/D) gene polymorphism is associated with NAFLD in the Egyptian population PMID: 28627263
Interleukin-1alpha induces release of interleukin-8 by human bronchial epithelial cells PMID: 28078769
the results indicate prominent antagonistic effects of IL-1alpha on TGF-beta regulated interferon signaling, as well as on a wide variety of other genes and pathways in fibroblasts. PMID: 26629874
IL1A polymorphism rs1800587 is associated with chronic pain in patients with sickle cell disease. PMID: 27883292
Data indicate that interleukin 1alpha (IL-1alpha) propiece can activate NF-kappa B (NFkappaB) and Sp1 transcription factor (SP1). PMID: 28152513
cytokines of the IL-1 family play an important role in homeostatic as well as "emergency" hematopoiesis and are involved in the pathogenesis of several myeloid and lymphoid hematological malignancies. PMID: 28483765
These results suggest that IL-1alpha enhances the translocation of TRPA1 to the plasma membrane via the activation of Erk in A549. PMID: 28629997
Single Nucleotide Variants of Candidate Genes in Aggrecan Metabolic Pathway Are Associated with Lumbar Disc Degeneration and Modic Changes PMID: 28081267
Polymorphisms of Il1a were not significantly associated with bipolar I disorder in Iranian patients. PMID: 28129679
This meta-analysis suggested that the IL-1alpha (+889C/T) polymorphism is significantly associated with risk of Intervertebral Disc Degeneration, especially in Caucasian populations. PMID: 27253397
we show that IL-1 induces robust p38a activation both in the nucleus and in the cytoplasm/membrane.Following stimulation, p38a activity returns to a basal level in absence of receptor degradation. While nuclear pulse is controlled by MKP1 through a negative feedback to pp38, its basal activity is controlled by both TAB1 and MKP1 through a positive feedback loop. PMID: 27314954
Key aspects of IL-1alpha biology and regulation, especially its emerging importance in the initiation and maintenance of inflammation that underlie the pathology of many human diseases, are reviewed. Review. PMID: 27434011
This study demonstrates that the rs3783553 polymorphism may be involved in susceptibility to endometrial cancer. The II genotype seems to be a protective factor for endometrial cancer in Chinese Han women. PMID: 27136893
Circulating Il1a levels were not altered in nonalcoholic fatty liver disease. PMID: 27493109
The IL-1alpha rs1800587 polymorphism demonstrated a significant association with the childhood type 1 diabetes mellitus risk. PMID: 27706611
The percentage of the -889 promotor SNP was similar but not overlapping in all the groups: periodontal disease only (40.8%), PD plus rheumatoid arthritis (50.2%), and PD plus NIDDM (46%). PMID: 27655512
this study shows that IL-1a gene variants are not associated with susceptibility to juvenile idiopathic arthritis in Iranian population PMID: 27717726
IL1 and IL6 are important components of the tumor microenvironment, displaying multiple functions. These cytokines take part at all stages of oncogenesis: from initiation to tumor, invasion, and metastasis of already established malignant and mutant epithelial cells. [Review] PMID: 27260388
IL-1genotype has no effect on Antibiotic Resistance on Helicobacter pylori Eradication. PMID: 27221874
Genetic polymorphisms in the IL1A, IL1B, IL2 and IL6 genes are not genetic modulators of depression in a cohort of Polish subjects. PMID: 26934083

Hide All

Subcellular Location

Cytoplasm. Secreted.

Protein Families

IL-1 family

Database Links

HGNC: 5991

OMIM: 147760

KEGG: hsa:3552

STRING: 9606.ENSP00000263339

UniGene: Hs.1722

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address