Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial

Code CSB-EP008543HU2
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FCGR3A
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
49-184aa
Target Protein Sequence
GAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
50.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene References into Functions
  1. Conditioned media or microparticles released from obese omental adipose tissue increased CD16 and CCR5 expression on CD14(+)CD16(-) monocytes and augmented their migratory capacity towards the conditioned media from obese omental adipose tissue, itself. PMID: 27677832
  2. results showed no association between FCGR3A 158V/F alleles and susceptibility to systemic lupus erythematosus PMID: 27914599
  3. High CD16(+) Monocyte is associated with Acute Rejection after Liver Transplantation. PMID: 29970436
  4. The analysis of Fc gamma receptor FCgammaRIIIA 158 V/f gene polymorphism showed that all 100 immune thrombocytopenic purpura (ITP) patients carry the wild FcgammaRIIIa (FF) genotype. PMID: 28856973
  5. CD16- monocyte subsets are upregulated in systemic lupus erythematous patients and may have a role in pathogenesis and development of this disease PMID: 28821990
  6. CD16 expression and morphological maturity of neutrophils are associated with higher iron ferritin levels in major beta-thalassemia. PMID: 29729700
  7. we propose a system of FCGR3A regulation in human NK cells in which CpG dinucleotide sequences and concurrent DNA methylation confer developmental and cell type-specific transcriptional regulation, whereas miR-218 provides an additional layer of posttranscriptional regulation during the maturation process. PMID: 29229679
  8. The study revealed that CD16-CD68-expressing macrophages appear to participate in ureteral neoplastic transformation. PMID: 29243545
  9. FCGR3A V158F polymorphism seems to be associated with anti-drug antibodies production against monoclonal antibodies targeting tumor necrosis factor (TNF) and it could be taken into account when considering the dose and type of anti-TNF in inflammatory bowel diseases patients. PMID: 29333082
  10. The study first identified that CNVs in the FCGR3A gene were associated with the risk of gout, and the CNV in the locus showed different distributions of frequency between gout patients and healthy subjects, particularly the frequency of the high FCGR3A copy number variant. PMID: 28405828
  11. Affimer proteins inhibit immune complex binding to FcgammaRIIIa with high specificity through competitive and allosteric modes of action. PMID: 29247053
  12. analysis of the assembly and surface expression of FcepsilonR1alpha in cells shows that CD16A associates equally well with human CD247 and FcepsilonR1gamma homodimers PMID: 28652325
  13. low copy numbers of FCGR2A and FCGR3B to be common risk factors for systemic lupus nephritis (SLE) and ANCA-associated systemic vasculitis (AASV). PMID: 28355982
  14. Memory-like differentiation resulted in enhanced IFN-gamma production triggered by leukemia targets or FcgammaRIIIa ligation within licensed NK cells, which exhibited the highest functionality of the NK cell subsets interrogated. PMID: 27894857
  15. We developed a semi-mechanistic model including a target-mediated elimination component that accurately described rituximab PK in patients with CLL. This allowed us to show for the first time an influence of a baseline count of target antigen and the FCGR3A-158V/F polymorphism on rituximab target-mediated elimination. PMID: 27783363
  16. FCGR3A-V158F polymorphism could be a specific marker for response to anti-TNFalpha therapy in psoriasis patients. PMID: 27044681
  17. The FCGR3A V allele correlated with the occurrence of late-onset neutropenia following rituximab treatment in patients with rheumatic diseases PMID: 28270182
  18. association between the antibody-dependent cellular cytotoxicity activity of adalimumab, an IgG reagent, in combination with FcgammaRIIIa -158V/F polymorphism (rs396991) PMID: 28913867
  19. CXCR7 mediates CD14(+)CD16(+) monocyte transmigration across the blood brain barrier, and is a potential therapeutic target for neuro AIDS. PMID: 28754798
  20. KIR/HLA-C complex and CD16A (48H/R/L,158V/F) gene polymorphisms in 52 colorectal cancer patients and 61 local healthy controls, are reported.. PMID: 27519478
  21. These data suggest a role for FcgammaRIIIa-pSyk cosignaling in modulating NA-TLR responses in human CD4(+) T cells by affecting the amounts and cellular distribution. These events are important for understanding of autoimmune pathology. PMID: 28500073
  22. This study demonstrated that no association between FCGR3A polymorphisms in Guillain-Barre Syndrome in a Brazilian population. PMID: 27609290
  23. Intermediate CD14++CD16+monocytes might be closely related to the pathogenesis of atrial fibrillation and reflect functional remodelling of the left atrium. PMID: 26826137
  24. Association between FcgammaRIIIa genetic polymorphisms and susceptibility to severe malaria anemia in children in western Kenya. PMID: 28427365
  25. FcgammaRIII3a-131H allele has a protective role in autoantibody production in Chinese rheumatoid arthritis patients. PMID: 28112584
  26. used a combination of NMR and 1 mus all-atom computational simulations to identify unexpected contacts between the N45 N-glycan and CD16A polypeptide residues PMID: 28613884
  27. We conclude that FCGR3A CNVs are a major risk factor for female sarcoidosis and FCGR3B CNVs may also affect the development of sarcoidosis. PMID: 27059607
  28. FcgammaRIIIa V allele-restricted pathological complete response benefit from neoadjuvant trastuzumab plus lapatinib in HER2+ breast cancer. PMID: 27378608
  29. CD16+ cells were significantly more frequent among Natural Killer (NK) cells negative for the inhibitory KIR (iKIR) KIR2DL1, KIR2DL3, and KIR3DL1 than those positive for any one of these iKIR to the exclusion of the others, making iKIR+ NK cells poorer antibody dependent cellular cytotoxicity effectors than iKIR- NK cells. PMID: 27732638
  30. The association of CD16a-inducible NK cell-selective transcripts CD160 and XCL1 with kidney biopsies with antibody-mediated rejection provides evidence for NK cell CD16a activation in AMR. PMID: 27906829
  31. expression of FcgammaR was not different between immune thrombocytopenia (ITP) and controls; the FCGR3A (158V/F) polymorphism, known to increase the affinity of FcgammaRIII to IgG, was over-represented in ITP patients PMID: 28142207
  32. Increased fraction of CD16(high) CD62L(dim) neutrophils was shown to correlate with an increased survival rate. PMID: 28247912
  33. Trastuzumab acidic variants had lesser binding to oncogene protein HER-2 (HER2) in comparison to the basic variants, and both acidic and basic variant showed no significant changes in their binding to soluble CD16a receptors. PMID: 28087106
  34. this study shows that FcgammaR single nucleotide polymorphisms are predisposing factors for urinary tract infections after kidney transplantation PMID: 28315348
  35. FCGR3A expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  36. this study shows that genetic polymorphisms located within an enhancer FCGR3A influence NK cell-mediated antibody-dependent cellular cytotoxicity PMID: 27338556
  37. CD16a resided in Kupffer cells, and it contributed to the inhibition of the growth of liver tumor cells. PMID: 27082928
  38. FcgammaRIIIA allelic distribution was similar among pediatric Guillain-Barre syndrome patients and controls. PMID: 27064330
  39. Anti-platelet drugs exert an immunomodulatory action by counteracting CD14(high)CD16(+) monocyte increase under pro-inflammatory conditions, with this effect being dependent on the amplitude of P-selectin reduction. PMID: 27118470
  40. analysis of natural killer cell markers in renal transplantation that have roles in acute rejection reveals that CD56 and CD57 are increased in the interstitial compartment in donor-specific antibody (DSA)-negative biopsies from patients with acute antibody-mediated rejection without C4d, and CD16 is increased in the glomerular compartment in DSA-positive biopsies PMID: 26615051
  41. Studies suggest that the Fc gamma receptor IIIA (FCGR3A) 158 V/F polymorphism can predict the treatment response to rituximab-based chemotherapy in non-Hodgkin lymphoma (NHL) patients. PMID: 27431582
  42. The incidences of the FCGR3A-158 variants VV, VF, and FF for nine patients with relapse were 0 (0 %), 8 (89 %), and 1 (11 %) compared to 13 (11 %), 61 (52 %), and 44 (37 %) in the 118 patients without relapse. PMID: 27376362
  43. Of 36 DLBCL patients, the distributions of F/F, V/F, and V/V types of alleles of FcgammaRIIIA were 25%, 50%, and 25%, respectively. The overall survival in the F/F allele group was found to be lower than in the other 2 groups, but the overall response rates were similar for all groups. PMID: 26316483
  44. Lower copy numbers (PMID: 26494566
  45. This metaanalysis indicates that polymorphisms in the pathways of immune complex clearance, such as the FcgammaRIIIa, FcgammaRIIIb, and ITGAM genotypes, are potential susceptibility genes for neuropsychiatric systemic lupus erythematosus. PMID: 26773105
  46. Data suggest a mechanism for the increased affinity of GASDALIE Fc for Fc receptor FcgammaRIIIa. PMID: 26850169
  47. Single-nucleotide polymorphisms of FCGR3A gene is associated with bloodstream infections After Liver Transplantation. PMID: 26517570
  48. These results suggest that the structure and expression of the CD16 molecule differs among FcgammaRIIIa-V158F genotypes, and the FcgammaRIIIa-V158F polymorphism may be represent a haplotype with other SNPs in regulatory regions in Japanese subjects. PMID: 26582002
  49. our method allows determining the CNV status of the FCGR locus, we identified association of CNV in FCGR3B to RA and showed a functional relationship between CNV in the FCGR3A gene and CD16A expression. PMID: 25966632
  50. KRAS wild chemorefractory metastatic colorectal cancer patients with genotype FF of V158F can benefit from cetuximab based therapy PMID: 26363448

Show More

Hide All

Involvement in disease
Immunodeficiency 20 (IMD20)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted. Note=Exists also as a soluble receptor.
Tissue Specificity
Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
Database Links

HGNC: 3619

OMIM: 146740

KEGG: hsa:2214

STRING: 9606.ENSP00000356946

UniGene: Hs.372679

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*