CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-CF008543HU |
Size | Pls inquire |
Source | in vitro E.coli expression system |
Have Questions? | Leave a Message or Start an on-line Chat |
Target Names | FCGR3A |
Uniprot No. | P08637 |
Alternative Names | CD 16; CD 16a; CD16; CD16a; CD16a antigen; CD16B; CD16b antigen; Fc fragment of IgG; Fc fragment of IgG low affinity IIIa receptor (CD16); Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG; low affinity III; receptor (CD16); Fc fragment of IgG; low affinity III; receptor for (CD16); Fc fragment of IgG; low affinity IIIa; receptor (CD16); Fc fragment of IgG; low affinity IIIa; receptor (CD16a); Fc fragment of IgG; low affinity IIIa; receptor for; Fc fragment of IgG; low affinity IIIb; receptor (CD16b); Fc fragment of IgG; low affinity IIIb; receptor for (CD16); Fc gamma R3; Fc gamma receptor III 2 (CD 16); Fc gamma receptor III A; Fc gamma receptor IIIA; Fc gamma receptor IIIb (CD 16); Fc gamma RIII alpha; Fc gamma RIII; Fc gamma RIII beta; Fc gamma RIIIa; Fc gamma RIIIb; Fc of IgG; Fc-gamma receptor III2 (CD 16); Fc-gamma receptor III2 (CD16); Fc-gamma receptor IIIb (CD16); Fc-gamma RIII; Fc-gamma RIII-alpha; Fc-gamma RIIIa; FCG 3; FCG3; FCG3A_HUMAN; FCgammaRIIIA; FCGR 3; FCGR 3A; FCGR3; FCGR3A; FCGR3A protein; FCGRIII; FCGRIII-2; FcR 10; FcR-10; FcR10; FcRIII; FcRIIIa; IGFR 3; IGFR3; IgG Fc receptor III 1; IgG Fc receptor III 2; IgG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; immunoglobulin G Fc receptor III-2; Low affinity IIIa receptor; Low affinity immunoglobulin gamma Fc region receptor III A; Low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor IIIB; neutrophil-specific antigen NA |
Species | Homo sapiens (Human) |
Expression Region | 17-254 |
Target Protein Sequence | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK |
Protein Length | Full Length of Mature Protein |
Tag Info | The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. |
Gene References into Functions |
|
Involvement in disease | Immunodeficiency 20 (IMD20) |
Subcellular Location | Cell membrane, Single-pass type I membrane protein, Secreted |
Tissue Specificity | Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts. |
Database Links |
HGNC: 3619 OMIM: 146740 KEGG: hsa:2214 STRING: 9606.ENSP00000356946 UniGene: Hs.372679 |
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide