Recombinant Human Son of sevenless homolog 1 (SOS1), partial

Code CSB-YP726788HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP726788HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP726788HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP726788HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP726788HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Son of sevenless homolog 1; SOS-1; SOS1
Species
Homo sapiens (Human)
Expression Region
780-1019
Target Protein Sequence
HPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPR
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes the exchange of Ras-bound GDP by GTP. Probably by promoting Ras activation, regulates phosphorylation of MAP kinase MAPK3 in response to EGF. Catalytic component of a trimeric complex that participates in transduction of signals from Ras to Rac by promoting the Rac-specific guanine nucleotide exchange factor (GEF) activity.
Gene References into Functions
  1. a distinct role of the C-terminal proline-rich (PR) domain of the full-length son of sevenless homolog 1 (SOS1) protein. PMID: 28452363
  2. SOS1 was statistically significantly associated with gestational diabetes mellitus risk after adjusting for multiple comparisons PMID: 29233017
  3. Findings identified p.Ser548Arg missense mutation in Son of Sevenless Homolog 1 (SOS1) in the boy, confirmed in his mother. PMID: 28456002
  4. We report on a novel pathogenic mutation in the SOS1 gene and a large clinical spectrum in a Noonan syndrome family with ten genetically confirmed affected individuals. PMID: 28884940
  5. Data indicate dynamic of H-Ras functional cycle as controlled by son of sevenless homolog 1 (Sos). PMID: 27412770
  6. In summary, patients from two families with history of non-syndromic autosomal-dominant HGF from Malopolska and Mazovia provinces in Poland had not been affected by HGF type 1, caused by a single-cytosine insertion in exon 21 of the SOS-1 gene. PMID: 28425619
  7. Mutation scanning of the entire coding sequence of SOS1 gene identified seven intronic variants and one new exonic substitution (c.138G > A). The seven common intronic variants were not considered to be of pathogenic importance. The exonic substitution c.138G > A was found to be absent in 100 ethnically matched normal control chromosomes, not expected to have functional significance based on prediction bioinformatics tool PMID: 28433619
  8. Grb2-independent interactions are sufficient to retain human SOS on the membrane for many minutes, during which a single SOS molecule could processively activate thousands of Ras molecules. PMID: 27501536
  9. a computational methodology that overlays any variant database onto the somatic mutations in all cancer exomes identified activating SOS1 mutations associated with Noonan syndrome as significantly altered in melanoma PMID: 27304678
  10. Data show that a heterozygous son of sevenless homolog 1 (SOS1) gene frameshift mutation (c.3266dup or c.3248dup) was identified in each patient. PMID: 26708403
  11. Ras.GDP weakly binds to the catalytic but not to the allosteric site of Sos. PMID: 26565026
  12. The present study provides a first evidence of allelic imbalance of SOS1 and pinpoints this condition as a possible mechanism underlying a different penetrance of some SOS1-mutated alleles in unrelated carriers PMID: 25712082
  13. In non-apoptotic cells, nuclear EGFR induced SOS1 expression by directly binding to the SOS1 promoter. PMID: 25980493
  14. rs963731 is associated with corticobasal degeneration. PMID: 26077951
  15. findings suggest that targeting the Src/Abl/Sos1/Rac pathway may represent a double-edged sword to control both cancer-invasive capacities and cancer-related inflammation. PMID: 26447228
  16. These data demonstrated the negative regulation between miR-146a and SOS1 and between miR-370 and GADD45beta and that these regulations are influenced by enterovirus 71 to induce apoptosis. PMID: 25469565
  17. Combined rational design and a high throughput screening platform for identifying chemical inhibitors of a Ras-activating enzyme. PMID: 25825487
  18. SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1. PMID: 25394671
  19. HGF-related mutation g.126,142-126,143insC in exon 21 was not found in any of the 6 affected individuals from three families. PMID: 25062969
  20. Stabilized alpha helices of son of sevenless 1 directly inhibit wild-type and mutant forms of KRAS. PMID: 25624485
  21. CIIA functions as a negative modulator of the SOS1-Ras signaling events initiated by peptide growth factors including EGF. PMID: 24522193
  22. Increased expression of SOS1 increases NFkappaB activation in several types of cancer cells, and ablation of SOS1 inhibits EGF-induced NFkappaB activation in these cells, indicating that SOS1 is a component of the pathway connecting EGFR to NFkappaB activation. PMID: 25071181
  23. sustained Erk signaling and T-cell activation depend on both Sos1 and RasGRP1. PMID: 24497027
  24. MiR-124 inhibits the growth of glioblastoma through the downregulation of SOS1. PMID: 23817964
  25. Although Sos1 and Gab1 recognize two non-overlapping sites within the Grb2 adaptor, allostery promotes the formation of two distinct pools of Grb2-Sos1 and Grb2-Gab1 binary signaling complexes in lieu of a composite Sos1-Grb2-Gab1 ternary complex. PMID: 23334917
  26. The SOS1 T158A mutation altered the phosphorylation of gene products involved in both RAS/MAPK and PI3K/AKT pathways. PMID: 23528009
  27. The PR domain displays a highly dynamic conformational basin in agreement with the knowledge that the intrinsically unstructured proteins rapidly interconvert between an ensemble of conformations. PMID: 23528987
  28. study established that the presence of SOS1, but not its enzymatic activity, is critical for p38 activation PMID: 23589333
  29. Oncogenic K-Ras promotes the activation of wild-type H- and N-Ras and this activation is mediated by oncogenic K-Ras-dependent allosteric stimulation of Sos. PMID: 23132018
  30. T-cell antigen receptor (TCR)-mediated Erk activation requires RasGRP1, but not Grb2/Sos. PMID: 22344067
  31. Modeling and simulation of aggregation of membrane protein LAT with molecular variability in the number of binding sites for cytosolic Grb2-SOS1-Grb2 PMID: 22396725
  32. We present a stochastic mathematical model describing intra-molecular regulation of hSos1 activity. PMID: 21851854
  33. multiple binding sites within Sos1 provide a physical route for Grb2 to hop in a flip-flop manner from one site to the next through facilitated diffusion, and such rapid exchange forms the basis of cooperativity driving bivalent binding of Grb2 to Sos1 PMID: 22360309
  34. SOS1 over-expression may play a role in the regulation of the RAS/mitogen-activated protein kinase pathway in the skin, in the hair follicle proliferation and cell cycle, suggesting new perspectives in understanding the pathogenesis of hirsutism. PMID: 22217993
  35. CIIA functions as a molecular switch for the GEF activity of SOS1, directing this activity toward Rac1. PMID: 22042618
  36. The researchers found evidence that there were significant differences between the D2S441 locus in the Maghreb population and other populations. PMID: 21674833
  37. this report expanded the available information about the molecular diversity of SOS1 mutations underlying Noonan syndrome, and have provided a more comprehensive assessment of the clinical features associated with those molecular lesions. PMID: 21387466
  38. Comparison of RasGEF expression at different developmental stages showed that relative to Sos2 and RasGRP1, Sos1 is most abundant in DN thymocytes, but least abundant in DP thymocytes. PMID: 21746917
  39. two unrelated patients with Noonan syndrome carrying the same heterozygous SOS1 missense mutation (c.1867T > A/p.F623I) PMID: 20673819
  40. A case mimicking CS with SOS1 T158A substitution, which has not been reported previously in CS, revealed the complex relationship between the genotype and phenotype of overlapping syndromes of the RAS/RAF/MEK/ERK pathway. PMID: 20030748
  41. This study investigated the regulation of the previously uncharacterized SOS1 gene promoter by the aryl hydrocarbon receptor and its ligands in HepG2 cells. PMID: 20950586
  42. mutation analysis performed on RAF1, SOS1, and GRB2, in 24 Noonan syndrome patients previously found to be negative for PTPN11 and KRAS mutations; SOS1 may have a role of modifier gene that might contribute the variable expressivity of the disease PMID: 20683980
  43. Noonan syndrome is due to a SOS1 missense mutation and rhabdomyosarcoma. PMID: 20607846
  44. Multiple decisive phosphorylation sites for the negative feedback regulation of SOS1 via ERK. PMID: 20724475
  45. Noonan-like/multiple giant cell lesion syndrome with mutations in the SOS1 gene PMID: 20305546
  46. Based on our results, it is possible that a subtle dysfunction (expression) of the SOS1 gene is involved in the development of the most common male reproductive tract disorder - unilateral or bilateral cryptorchidism PMID: 20389169
  47. a new crystal structure of SOS at 3.2 A resolution was presented that contains the histone domain and the DH-PH unit in addition to the catalytic segment (SOSHDPC, residues 1-1049). PMID: 20133692
  48. Sos-histone domain plays a critical role in governing the catalytic output of Sos through the coupling of membrane recruitment to the release of autoinhibition. PMID: 20133694
  49. First report describing different tumor types in Noonan syndrome with germline SOS1 mutations. PMID: 19953625
  50. The binding of Grb2 adaptor to its downstream partners Sos1 and Gab1 docker is under tight allosteric regulation. PMID: 20005866

Show More

Hide All

Involvement in disease
Fibromatosis, gingival, 1 (GINGF1); Noonan syndrome 4 (NS4)
Tissue Specificity
Expressed in gingival tissues.
Database Links

HGNC: 11187

OMIM: 135300

KEGG: hsa:6654

STRING: 9606.ENSP00000384675

UniGene: Hs.709893

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1