Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

Code CSB-RP072244h
Product Type Recombinant Protein
Size US$1726
Uniprot No. P19438
Relevance Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Tumor necrosis factor receptor 1 ;TNF-R1Tumor necrosis factor receptor type I ;TNF-RI ;TNFR-Ip55p60; CD120a
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT
Research Area Apoptosis
Source E.coli
Gene Names TNFRSF1A
Expression Region 31-210aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Involvement in disease Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)
Subcellular Location Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted
Database Links

HGNC: 11916

OMIM: 142680

KEGG: hsa:7132

STRING: 9606.ENSP00000162749

UniGene: Hs.279594

Pathway MAPK signaling pathway
mTOR signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Osteoclast differentiation
Adipocytokine signaling pathway

Related Products

TNFRSF1A Antibodies

TNFRSF1A Antibodies for Homo sapiens (Human)

TNFRSF1A ELISA Kit

TNFRSF1A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.