Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial (Active)

In Stock
Code CSB-AP004971HU
Product Type Tumor Necrosis Factor
Size $137Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P19438
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D.?
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Research Area Cancer
Source E.coli
Gene Names TNFRSF1A
Expression Region 22-211aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.5 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Involvement in disease Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)
Subcellular Location Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted
Database Links

HGNC: 11916

OMIM: 142680

KEGG: hsa:7132

STRING: 9606.ENSP00000162749

UniGene: Hs.279594

Pathway MAPK signaling pathway
mTOR signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Osteoclast differentiation
Adipocytokine signaling pathway

Related Products

TNFRSF1A Antibodies

TNFRSF1A Antibodies for Homo sapiens (Human)

TNFRSF1A ELISA Kit

TNFRSF1A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.