Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA(CSB-MP013218HU) at 5 μg/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml.
Alternative Names
(TNF-R1)(Tumor necrosis factor receptor type I)(TNF-RI)(TNFR-I)(p55)(p60)(CD120a)(TNFAR)(TNFR1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
22-211aa
Target Protein Sequence
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
A construct encoding COOH-terminally hFc-tagged human TNFRSF1A was expressed in mammalian cells. The resulting protein is the recombinant TNFRSF1A protein containing amino acid sequence 22-211 of human TNFRSF1A. The purity of this TNFRSF1A protein is greater than 90% determined by SDS-PAGE. A molecular mass band of 55 kDa was presented on the gel under reducing conditions. It contains low levels of endotoxin, less than 1.0 EU/ug determined by the LAL method. And this TNFRSF1A protein has also been tested as an active protein through the functional ELISA. This TNFRSF1A protein can bind to TNF-α or LTA, with the EC50 of 7.799-10.90 ng/ml or 4.409-6.797 ng/ml. It is available now.
TNFRSF1A, also called TNFR1, is a death receptor (DR) and also a central mediator in the signal transduction of the inflammatory pathway. The treatment of autoimmune diseases such as rheumatoid arthritis has been targeted to inhibit TNFR1, while activation of TNFR1 is critical for the treatment of immunodeficiency diseases such as HIV and neurodegenerative diseases such as Alzheimer's disease.