Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial

In Stock
Code CSB-EP020067HU
Abbreviation Recombinant Human ROR1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
dJ537F10.1; Inactive tyrosine protein kinase transmembrane receptor ROR1; MGC99659; Neurotrophic tyrosine kinase; Neurotrophic tyrosine kinase receptor related 1; Neurotrophic tyrosine kinase; receptor related 1; NTRKR1; OTTHUMP00000010573; OTTHUMP00000010574; OTTMUSP00000008344; Receptor tyrosine kinase like orphan receptor 1; receptor-related 1; RGD1559469; ROR 1; ROR1; ROR1_HUMAN; RP11 24J23.1; Tyrosine kinase like orphan receptor 1 ; Tyrosine protein kinase transmembrane receptor ROR1; Tyrosine-protein kinase transmembrane receptor ROR1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-391aa
Target Protein Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.6kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of the recombinant Human ROR1 protein begins with the creation of the recombinant plasmid, which is synthesized by inserting the gene encoding the Human ROR1 protein (30-391aa) into a plasmid vector. The recombinant plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected and then cultured under conditions conducive to the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis tag. Following expression, the recombinant ROR1 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Human ROR1 protein, demonstrating a purity exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells.
Gene References into Functions
  1. this study found that in scid hu mice, ROR1 was highly expressed in a proportion of bone marrow, spleen, and blood B cells, which were mostly immature B cells PMID: 29850623
  2. Results find ROR1 as the direct target of miR30a, and show that ROR1 contributes to mir30amediated suppression of TNBC (triple negative breast cancer) cell invasion and migration. PMID: 29693179
  3. ROR1 and ROR2 play distinct roles in endometrial cancer. ROR1 may promote tumor progression, while ROR2 may act as a tumor suppressor in endometrioid endometrial cancer. PMID: 29395309
  4. ROR1 is a promising immunotherapeutic target in many epithelial tumors; however, high cell surface ROR1 expression in multiple normal tissues raises concerns for on-target off-tumor toxicities. Clinical translation of ROR1-targeted therapies warrants careful monitoring of toxicities to normal organs and may require strategies to ensure patient safety PMID: 27852699
  5. Report shows that ROR1 is highly expressed in colorectal cancer (CRC) tissues when compared with their adjacent normal tissues. The Kaplan-Meier curve indicated that the CRC patients with higher ROR1 expression had significantly shorter overall survival (OS), and those with lower ROR1 expression had longer OS. PMID: 28427197
  6. this study reveals that 14-3-3zeta plays a critical role in Wnt5a/ROR1 signaling, leading to enhanced CLL migration and proliferation. PMID: 28465528
  7. these studies indicate HS1 plays an important role in ROR1-dependent Wnt5a-enhanced chemokine-directed leukemia-cell migration. PMID: 28465529
  8. This study demonstrates expression of ROR1 and its putative ligand Wnt5a in Ewing sarcomas, and of an active ROR1 protein variant in cell lines. ROR1 silencing impaired cell migration in vitro. PMID: 26739507
  9. expression of ROR1 may promote leukemia-cell activation and survival and enhance disease progression in patients with chronic lymphocytic leukemia. PMID: 27815263
  10. the mechanistic regulation and linkage of the ROR1-HER3 and Hippo-YAP pathway in a cancer-specific context PMID: 28114269
  11. Data show that ROR1 contributes to melanoma progression by promoting cell growth and migration. PMID: 26509654
  12. High ROR1-DNAJC6 expression is associated with neoplasms. PMID: 27153396
  13. we aim to present an overview of the efforts and scientific achievements in targeting ROR family, particularly ROR-1, for the diagnosis and treatment of chronic lymphocytic leukemia --{REVIEW} PMID: 28160756
  14. that strong ROR1 expression might be an independent adverse prognostic factor in triple negative breast cancer PMID: 26874851
  15. Ror1 is crucial for spiral ganglion neurons to innervate auditory hair cells. Impairment of ROR1 function largely affects development of the inner ear and hearing in humans and mice. PMID: 27162350
  16. targeting ROR1 can induce differentiation of cancer stem cells and inhibit metastasis in glioblastoma; in addition, ROR1 may be used as a potential marker for glioblastoma stem cells as well as a potential target for glioblastoma stem cell therapy PMID: 26923195
  17. expression of ROR1 was significantly higher in colorectal carcinoma tissues than in tumor-adjacent tissues PMID: 27126945
  18. these findings revealed that miR382 inhibits migration and invision by targeting ROR1 through regulating EMT in ovarian cancer, and might serve as a tumor suppressor in ovarian cancer. PMID: 26575700
  19. Data show that silencing receptor tyrosine kinases (RTKs) ROR2 and ROR1 has a strong inhibitory effect on the ability of ovarian cancer cells to proliferate, migrate and invade. PMID: 26515598
  20. the b-catenin-independent WNT score correlated with reduced overall survival only in the metastasized situation . This is in line with the in vitro results of the alternative WNT receptors ROR1 and ROR2, which foster invasion PMID: 26862065
  21. The present findings thus support our notion that ROR1 sustains lung adenocarcinoma survival, at least in part, through direct physical interaction with ASK1 PMID: 26661061
  22. High expression of ROR1 (63%), pAkt (36%), and pCREB (20%) was observed in gastric adenocarcinomas, and expression of these proteins was well intercorrelated. PMID: 26245996
  23. This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation. PMID: 26690702
  24. miR-27b-3p suppresses cell proliferation through targeting receptor tyrosine kinase like orphan receptor 1 in gastric cancer PMID: 26576539
  25. Data show that the majority of chronic lymphocytic leukemia (CLL) patients had antibodies against receptor tyrosine kinase ROR1. PMID: 26562161
  26. This study reports an unanticipated function of ROR1 as a scaffold of cavin-1 and caveolin-1, two essential structural components of caveolae. PMID: 26725982
  27. Both IGF1R and ROR1 can be effectively targeted by SB modified CAR T cells. PMID: 26173023
  28. Significantly down-regulates the activity of the PI3K/AKT/mTOR signaling pathway. PMID: 25978653
  29. Human ROR1 and ROR2 are receptor tyrosine kinase-like pseudokinases. PMID: 25029443
  30. The newly developed OSU-2S delivery using ROR1-directed immunonanoparticles provide selective targeting of OSU-2S to MCL and other ROR1(+) malignancies, sparing normal B cells. PMID: 25937048
  31. ROR1 expression is correlated with malignant attributes of ovarian cancer and it may serve as a novel prognostic marker in ovarian cancer. PMID: 25056203
  32. Data indicate that shRNA silencing of type I receptor tyrosine kinase-like orphan receptor (ROR1) cells, or treatment with anti-ROR1 mAb UC-961 impaired the capacity of ovarian cancer cells to form spheroids or tumor xenografts. PMID: 25411317
  33. ROR1 is only detectable in embryonic tissue and generally absent in adult tissue, making the protein an ideal drug target for cancer therapy. [Review] PMID: 24752542
  34. CLL cells expressed different isoforms of ROR1. PMID: 24205204
  35. Data shows that ROR1 and ROR2 are inversely expressed in melanomas and negatively regulate each other. Also, hypoxia initiates a shift of ROR1-positive melanomas to a more invasive, ROR2-positive phenotype. PMID: 24104062
  36. ROR1 can interact with TCL1 and enhance leukemogenesis in Emu-TCL1 transgenic mice. PMID: 24379361
  37. Our results show that customizing spacer design and increasing affinity of ROR1-CARs enhances T-cell effector function and recognition of ROR1(+) tumors. PMID: 23620405
  38. ROR1 may play a role in the survival of melanoma cells PMID: 23593420
  39. Data indicate that type I receptor tyrosine kinase-like orphan receptor ROR1 may regulate EMT and metastasis and that antibodies targeting ROR1 can inhibit cancer progression and metastasis. PMID: 23771907
  40. that the receptor tyrosine kinase ROR1 was overexpressed in most patients with various hematological malignancies of both lymphoid and myeloid origins. PMID: 22988987
  41. cell surface expression in pediatric B-ALL along with its virtual absence from normal tissues and circulating cells makes ROR1 a promising target for mAb-based therapies. PMID: 23285131
  42. Many different human cancers express ROR1 and ROR1 may play a functional role in promoting tumor cell growth. PMID: 23041612
  43. t(1;19) Acute Lymphoblastic Leukemia cells universally exhibit expression of and dependence on the cell surface receptor ROR1. PMID: 23153538
  44. ROR1 was overexpressed in acute lymphoblastic leukemia PMID: 22369092
  45. ROR1 is expressed in human breast cancers and has biological and clinical significance PMID: 22403610
  46. nuclear-localized ROR1 may play an important role in cell migration and cytoskeleton remodeling PMID: 22199287
  47. Ror1 undergoes complex post-translational modifications by glycosylation and mono-ubiquitination. These modifications regulate Ror1 localization and signalling, and are highly variable among individual chronic lymphocytic leukemia patients. PMID: 21481194
  48. ROR1 is uniformly and highly expressed in all in chronic lymphocytic leukemia (CLL) cases at initial diagnosis and can serve as a diagnostic tool. PMID: 21531460
  49. ROR1 is expressed on hematogones (non-neoplastic human B-lymphocyte precursors) and a minority of precursor-B acute lymphoblastic leukemia. PMID: 21813176
  50. A panel of mAbs demonstrated high affinity and specificity for a diverse set of epitopes that involve all three extracellular domains of ROR1, are accessible on the cell surface, and mediate internalization PMID: 21698301

Show More

Hide All

Involvement in disease
Deafness, autosomal recessive, 108 (DFNB108)
Subcellular Location
Membrane; Single-pass type I membrane protein. Cell projection, axon.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, ROR subfamily
Tissue Specificity
Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Database Links

HGNC: 10256

OMIM: 602336

KEGG: hsa:4919

STRING: 9606.ENSP00000360120

UniGene: Hs.128753

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*