Code | CSB-MP020067HU1d7 |
Size | $468 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The DNA fragment encoding the human ROR1 (30-403 AA) was fused with the C-terminal 10xHis-tag and then expressed in the mammalian cells. The resultant product is the recombinant partial-length human ROR1 protein. This ROR1 protein is active, and its activity has been assayed by binding to the anti-ROR1 antibody in a functional ELISA. It has high purity (>95%, SDS-PAGE) and low endotoxin content (<1.0 EU/ug of the protein, LAL method). Under the reducing conditions, this ROR1 protein showed a molecular weight of about 55 kDa on the gel. It is in stock now. ROR1 is lowly or not expressed in normal human tissues, but highly expressed in a variety of blood tumors and solid tumors. ROR1 binds to Wnt5a, activating noncanonical Wnt signaling pathways involving multiple biological processes, including the regulation of cell division, proliferation, migration, and cell chemotaxis. Being a specific tumor marker and the potential target for the tumor therapy, several anti-cancer treatments based on ROR1 has been developed, including antibody-drug conjugate (ADC), monoclonal antibody, bispecific antibody, and CAR-T therapy. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody(CSB-RA020067A1HU), the EC50 is 0.2450-0.3416 ng/mL. |
Target Names | ROR1 |
Uniprot No. | Q01973 |
Research Area | Neuroscience |
Alternative Names | (Neurotrophic tyrosine kinase, receptor-related 1) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 30-403aa |
Target Protein Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME |
Mol. Weight | 44.8 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 10xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells.
|
Gene References into Functions |
|
Involvement in disease | Deafness, autosomal recessive, 108 (DFNB108) |
Subcellular Location | Membrane; Single-pass type I membrane protein. Cell projection, axon. |
Protein Families | Protein kinase superfamily, Tyr protein kinase family, ROR subfamily |
Tissue Specificity | Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm. |
Database Links |
HGNC: 10256 OMIM: 602336 KEGG: hsa:4919 STRING: 9606.ENSP00000360120 UniGene: Hs.128753 |