Product Details

Purity

Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC₅₀ is 0.2450-0.3416 ng/mL.

Target Names

ROR1

Uniprot No.

Q01973

Research Area

Neuroscience

Alternative Names

(Neurotrophic tyrosine kinase, receptor-related 1)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

30-403aa

Target Protein Sequence

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Mol. Weight

44.8 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human ROR1 is a partial protein derived from mammalian cells, specifically containing the 30-403aa expression region of the Inactive tyrosine-protein kinase transmembrane receptor ROR1. This high-purity protein (greater than 95% as determined by SDS-PAGE) is C-terminal 10xHis-tagged and has an endotoxin level of less than 1.0 EU/µg, as established by the LAL method. ROR1 is primarily utilized in neuroscience research, with its binding ability measured in a functional ELISA. When immobilized at 2 μg/mL, it can bind anti-ROR1 antibody（CSB-RA020067A1HU) with an EC₅₀ of 0.2450-0.3416 ng/mL. The lyophilized powder format ensures easy handling and storage for a variety of research applications.

Target Background

Function

Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells.

Gene References into Functions

this study found that in scid hu mice, ROR1 was highly expressed in a proportion of bone marrow, spleen, and blood B cells, which were mostly immature B cells PMID: 29850623
Results find ROR1 as the direct target of miR30a, and show that ROR1 contributes to mir30amediated suppression of TNBC (triple negative breast cancer) cell invasion and migration. PMID: 29693179
ROR1 and ROR2 play distinct roles in endometrial cancer. ROR1 may promote tumor progression, while ROR2 may act as a tumor suppressor in endometrioid endometrial cancer. PMID: 29395309
ROR1 is a promising immunotherapeutic target in many epithelial tumors; however, high cell surface ROR1 expression in multiple normal tissues raises concerns for on-target off-tumor toxicities. Clinical translation of ROR1-targeted therapies warrants careful monitoring of toxicities to normal organs and may require strategies to ensure patient safety PMID: 27852699
Report shows that ROR1 is highly expressed in colorectal cancer (CRC) tissues when compared with their adjacent normal tissues. The Kaplan-Meier curve indicated that the CRC patients with higher ROR1 expression had significantly shorter overall survival (OS), and those with lower ROR1 expression had longer OS. PMID: 28427197
this study reveals that 14-3-3zeta plays a critical role in Wnt5a/ROR1 signaling, leading to enhanced CLL migration and proliferation. PMID: 28465528
these studies indicate HS1 plays an important role in ROR1-dependent Wnt5a-enhanced chemokine-directed leukemia-cell migration. PMID: 28465529
This study demonstrates expression of ROR1 and its putative ligand Wnt5a in Ewing sarcomas, and of an active ROR1 protein variant in cell lines. ROR1 silencing impaired cell migration in vitro. PMID: 26739507
expression of ROR1 may promote leukemia-cell activation and survival and enhance disease progression in patients with chronic lymphocytic leukemia. PMID: 27815263
the mechanistic regulation and linkage of the ROR1-HER3 and Hippo-YAP pathway in a cancer-specific context PMID: 28114269
Data show that ROR1 contributes to melanoma progression by promoting cell growth and migration. PMID: 26509654
High ROR1-DNAJC6 expression is associated with neoplasms. PMID: 27153396
we aim to present an overview of the efforts and scientific achievements in targeting ROR family, particularly ROR-1, for the diagnosis and treatment of chronic lymphocytic leukemia --{REVIEW} PMID: 28160756
that strong ROR1 expression might be an independent adverse prognostic factor in triple negative breast cancer PMID: 26874851
Ror1 is crucial for spiral ganglion neurons to innervate auditory hair cells. Impairment of ROR1 function largely affects development of the inner ear and hearing in humans and mice. PMID: 27162350
targeting ROR1 can induce differentiation of cancer stem cells and inhibit metastasis in glioblastoma; in addition, ROR1 may be used as a potential marker for glioblastoma stem cells as well as a potential target for glioblastoma stem cell therapy PMID: 26923195
expression of ROR1 was significantly higher in colorectal carcinoma tissues than in tumor-adjacent tissues PMID: 27126945
these findings revealed that miR382 inhibits migration and invision by targeting ROR1 through regulating EMT in ovarian cancer, and might serve as a tumor suppressor in ovarian cancer. PMID: 26575700
Data show that silencing receptor tyrosine kinases (RTKs) ROR2 and ROR1 has a strong inhibitory effect on the ability of ovarian cancer cells to proliferate, migrate and invade. PMID: 26515598
the b-catenin-independent WNT score correlated with reduced overall survival only in the metastasized situation . This is in line with the in vitro results of the alternative WNT receptors ROR1 and ROR2, which foster invasion PMID: 26862065
The present findings thus support our notion that ROR1 sustains lung adenocarcinoma survival, at least in part, through direct physical interaction with ASK1 PMID: 26661061
High expression of ROR1 (63%), pAkt (36%), and pCREB (20%) was observed in gastric adenocarcinomas, and expression of these proteins was well intercorrelated. PMID: 26245996
This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation. PMID: 26690702
miR-27b-3p suppresses cell proliferation through targeting receptor tyrosine kinase like orphan receptor 1 in gastric cancer PMID: 26576539
Data show that the majority of chronic lymphocytic leukemia (CLL) patients had antibodies against receptor tyrosine kinase ROR1. PMID: 26562161
This study reports an unanticipated function of ROR1 as a scaffold of cavin-1 and caveolin-1, two essential structural components of caveolae. PMID: 26725982
Both IGF1R and ROR1 can be effectively targeted by SB modified CAR T cells. PMID: 26173023
Significantly down-regulates the activity of the PI3K/AKT/mTOR signaling pathway. PMID: 25978653
Human ROR1 and ROR2 are receptor tyrosine kinase-like pseudokinases. PMID: 25029443
The newly developed OSU-2S delivery using ROR1-directed immunonanoparticles provide selective targeting of OSU-2S to MCL and other ROR1(+) malignancies, sparing normal B cells. PMID: 25937048
ROR1 expression is correlated with malignant attributes of ovarian cancer and it may serve as a novel prognostic marker in ovarian cancer. PMID: 25056203
Data indicate that shRNA silencing of type I receptor tyrosine kinase-like orphan receptor (ROR1) cells, or treatment with anti-ROR1 mAb UC-961 impaired the capacity of ovarian cancer cells to form spheroids or tumor xenografts. PMID: 25411317
ROR1 is only detectable in embryonic tissue and generally absent in adult tissue, making the protein an ideal drug target for cancer therapy. [Review] PMID: 24752542
CLL cells expressed different isoforms of ROR1. PMID: 24205204
Data shows that ROR1 and ROR2 are inversely expressed in melanomas and negatively regulate each other. Also, hypoxia initiates a shift of ROR1-positive melanomas to a more invasive, ROR2-positive phenotype. PMID: 24104062
ROR1 can interact with TCL1 and enhance leukemogenesis in Emu-TCL1 transgenic mice. PMID: 24379361
Our results show that customizing spacer design and increasing affinity of ROR1-CARs enhances T-cell effector function and recognition of ROR1(+) tumors. PMID: 23620405
ROR1 may play a role in the survival of melanoma cells PMID: 23593420
Data indicate that type I receptor tyrosine kinase-like orphan receptor ROR1 may regulate EMT and metastasis and that antibodies targeting ROR1 can inhibit cancer progression and metastasis. PMID: 23771907
that the receptor tyrosine kinase ROR1 was overexpressed in most patients with various hematological malignancies of both lymphoid and myeloid origins. PMID: 22988987
cell surface expression in pediatric B-ALL along with its virtual absence from normal tissues and circulating cells makes ROR1 a promising target for mAb-based therapies. PMID: 23285131
Many different human cancers express ROR1 and ROR1 may play a functional role in promoting tumor cell growth. PMID: 23041612
t(1;19) Acute Lymphoblastic Leukemia cells universally exhibit expression of and dependence on the cell surface receptor ROR1. PMID: 23153538
ROR1 was overexpressed in acute lymphoblastic leukemia PMID: 22369092
ROR1 is expressed in human breast cancers and has biological and clinical significance PMID: 22403610
nuclear-localized ROR1 may play an important role in cell migration and cytoskeleton remodeling PMID: 22199287
Ror1 undergoes complex post-translational modifications by glycosylation and mono-ubiquitination. These modifications regulate Ror1 localization and signalling, and are highly variable among individual chronic lymphocytic leukemia patients. PMID: 21481194
ROR1 is uniformly and highly expressed in all in chronic lymphocytic leukemia (CLL) cases at initial diagnosis and can serve as a diagnostic tool. PMID: 21531460
ROR1 is expressed on hematogones (non-neoplastic human B-lymphocyte precursors) and a minority of precursor-B acute lymphoblastic leukemia. PMID: 21813176
A panel of mAbs demonstrated high affinity and specificity for a diverse set of epitopes that involve all three extracellular domains of ROR1, are accessible on the cell surface, and mediate internalization PMID: 21698301

Hide All

Involvement in disease

Deafness, autosomal recessive, 108 (DFNB108)

Subcellular Location

Membrane; Single-pass type I membrane protein. Cell projection, axon.

Protein Families

Protein kinase superfamily, Tyr protein kinase family, ROR subfamily

Tissue Specificity

Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.

Database Links

HGNC: 10256

OMIM: 602336

KEGG: hsa:4919

STRING: 9606.ENSP00000360120

UniGene: Hs.128753

Code	CSB-MP020067HU1d7
Abbreviation	Recombinant Human ROR1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/ml can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC₅₀ is 0.2450-0.3416 ng/mL. Biological Activity Assay The purity of ROR1 was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage