Name: Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial (Active)
Brand: CUSABIO
SKU: CSB-MP020067HU1d7

Product Details

Description	The DNA fragment encoding the human ROR1 (30-403 AA) was fused with the C-terminal 10xHis-tag and then expressed in the mammalian cells. The resultant product is the recombinant partial-length human ROR1 protein. This ROR1 protein is active, and its activity has been assayed by binding to the anti-ROR1 antibody in a functional ELISA. It has high purity (>95%, SDS-PAGE) and low endotoxin content (<1.0 EU/ug of the protein, LAL method). Under the reducing conditions, this ROR1 protein showed a molecular weight of about 55 kDa on the gel. It is in stock now. ROR1 is lowly or not expressed in normal human tissues, but highly expressed in a variety of blood tumors and solid tumors. ROR1 binds to Wnt5a, activating noncanonical Wnt signaling pathways involving multiple biological processes, including the regulation of cell division, proliferation, migration, and cell chemotaxis. Being a specific tumor marker and the potential target for the tumor therapy, several anti-cancer treatments based on ROR1 has been developed, including antibody-drug conjugate (ADC), monoclonal antibody, bispecific antibody, and CAR-T therapy.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC₅₀ is 0.2450-0.3416 ng/mL.
Target Names	ROR1
Uniprot No.	Q01973
Research Area	Neuroscience
Alternative Names	(Neurotrophic tyrosine kinase, receptor-related 1)
Molecular Characterization
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	30-403aa
Target Protein Sequence	QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Mol. Weight	44.8 kDa
Protein Length	Partial
Tag Info	C-terminal 10xHis-tagged
Form	Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function (From Uniprot)	Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo
Gene References into Functions	this study found that in scid hu mice, ROR1 was highly expressed in a proportion of bone marrow, spleen, and blood B cells, which were mostly immature B cells PMID: 29850623 Results find ROR1 as the direct target of miR30a, and show that ROR1 contributes to mir30amediated suppression of TNBC (triple negative breast cancer) cell invasion and migration. PMID: 29693179 ROR1 and ROR2 play distinct roles in endometrial cancer. ROR1 may promote tumor progression, while ROR2 may act as a tumor suppressor in endometrioid endometrial cancer. PMID: 29395309 ROR1 is a promising immunotherapeutic target in many epithelial tumors; however, high cell surface ROR1 expression in multiple normal tissues raises concerns for on-target off-tumor toxicities. Clinical translation of ROR1-targeted therapies warrants careful monitoring of toxicities to normal organs and may require strategies to ensure patient safety PMID: 27852699 Report shows that ROR1 is highly expressed in colorectal cancer (CRC) tissues when compared with their adjacent normal tissues. The Kaplan-Meier curve indicated that the CRC patients with higher ROR1 expression had significantly shorter overall survival (OS), and those with lower ROR1 expression had longer OS. PMID: 28427197 this study reveals that 14-3-3zeta plays a critical role in Wnt5a/ROR1 signaling, leading to enhanced CLL migration and proliferation. PMID: 28465528 these studies indicate HS1 plays an important role in ROR1-dependent Wnt5a-enhanced chemokine-directed leukemia-cell migration. PMID: 28465529 This study demonstrates expression of ROR1 and its putative ligand Wnt5a in Ewing sarcomas, and of an active ROR1 protein variant in cell lines. ROR1 silencing impaired cell migration in vitro. PMID: 26739507 expression of ROR1 may promote leukemia-cell activation and survival and enhance disease progression in patients with chronic lymphocytic leukemia. PMID: 27815263 the mechanistic regulation and linkage of the ROR1-HER3 and Hippo-YAP pathway in a cancer-specific context PMID: 28114269 Data show that ROR1 contributes to melanoma progression by promoting cell growth and migration. PMID: 26509654 High ROR1-DNAJC6 expression is associated with neoplasms. PMID: 27153396 we aim to present an overview of the efforts and scientific achievements in targeting ROR family, particularly ROR-1, for the diagnosis and treatment of chronic lymphocytic leukemia --{REVIEW} PMID: 28160756 that strong ROR1 expression might be an independent adverse prognostic factor in triple negative breast cancer PMID: 26874851 Ror1 is crucial for spiral ganglion neurons to innervate auditory hair cells. Impairment of ROR1 function largely affects development of the inner ear and hearing in humans and mice. PMID: 27162350 targeting ROR1 can induce differentiation of cancer stem cells and inhibit metastasis in glioblastoma; in addition, ROR1 may be used as a potential marker for glioblastoma stem cells as well as a potential target for glioblastoma stem cell therapy PMID: 26923195 expression of ROR1 was significantly higher in colorectal carcinoma tissues than in tumor-adjacent tissues PMID: 27126945 these findings revealed that miR382 inhibits migration and invision by targeting ROR1 through regulating EMT in ovarian cancer, and might serve as a tumor suppressor in ovarian cancer. PMID: 26575700 Data show that silencing receptor tyrosine kinases (RTKs) ROR2 and ROR1 has a strong inhibitory effect on the ability of ovarian cancer cells to proliferate, migrate and invade. PMID: 26515598 the b-catenin-independent WNT score correlated with reduced overall survival only in the metastasized situation . This is in line with the in vitro results of the alternative WNT receptors ROR1 and ROR2, which foster invasion PMID: 26862065 The present findings thus support our notion that ROR1 sustains lung adenocarcinoma survival, at least in part, through direct physical interaction with ASK1 PMID: 26661061 High expression of ROR1 (63%), pAkt (36%), and pCREB (20%) was observed in gastric adenocarcinomas, and expression of these proteins was well intercorrelated. PMID: 26245996 This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation. PMID: 26690702 miR-27b-3p suppresses cell proliferation through targeting receptor tyrosine kinase like orphan receptor 1 in gastric cancer PMID: 26576539 Data show that the majority of chronic lymphocytic leukemia (CLL) patients had antibodies against receptor tyrosine kinase ROR1. PMID: 26562161 This study reports an unanticipated function of ROR1 as a scaffold of cavin-1 and caveolin-1, two essential structural components of caveolae. PMID: 26725982 Both IGF1R and ROR1 can be effectively targeted by SB modified CAR T cells. PMID: 26173023 Significantly down-regulates the activity of the PI3K/AKT/mTOR signaling pathway. PMID: 25978653 Human ROR1 and ROR2 are receptor tyrosine kinase-like pseudokinases. PMID: 25029443 The newly developed OSU-2S delivery using ROR1-directed immunonanoparticles provide selective targeting of OSU-2S to MCL and other ROR1(+) malignancies, sparing normal B cells. PMID: 25937048 ROR1 expression is correlated with malignant attributes of ovarian cancer and it may serve as a novel prognostic marker in ovarian cancer. PMID: 25056203 Data indicate that shRNA silencing of type I receptor tyrosine kinase-like orphan receptor (ROR1) cells, or treatment with anti-ROR1 mAb UC-961 impaired the capacity of ovarian cancer cells to form spheroids or tumor xenografts. PMID: 25411317 ROR1 is only detectable in embryonic tissue and generally absent in adult tissue, making the protein an ideal drug target for cancer therapy. [Review] PMID: 24752542 CLL cells expressed different isoforms of ROR1. PMID: 24205204 Data shows that ROR1 and ROR2 are inversely expressed in melanomas and negatively regulate each other. Also, hypoxia initiates a shift of ROR1-positive melanomas to a more invasive, ROR2-positive phenotype. PMID: 24104062 ROR1 can interact with TCL1 and enhance leukemogenesis in Emu-TCL1 transgenic mice. PMID: 24379361 Our results show that customizing spacer design and increasing affinity of ROR1-CARs enhances T-cell effector function and recognition of ROR1(+) tumors. PMID: 23620405 ROR1 may play a role in the survival of melanoma cells PMID: 23593420 Data indicate that type I receptor tyrosine kinase-like orphan receptor ROR1 may regulate EMT and metastasis and that antibodies targeting ROR1 can inhibit cancer progression and metastasis. PMID: 23771907 that the receptor tyrosine kinase ROR1 was overexpressed in most patients with various hematological malignancies of both lymphoid and myeloid origins. PMID: 22988987 cell surface expression in pediatric B-ALL along with its virtual absence from normal tissues and circulating cells makes ROR1 a promising target for mAb-based therapies. PMID: 23285131 Many different human cancers express ROR1 and ROR1 may play a functional role in promoting tumor cell growth. PMID: 23041612 t(1;19) Acute Lymphoblastic Leukemia cells universally exhibit expression of and dependence on the cell surface receptor ROR1. PMID: 23153538 ROR1 was overexpressed in acute lymphoblastic leukemia PMID: 22369092 ROR1 is expressed in human breast cancers and has biological and clinical significance PMID: 22403610 nuclear-localized ROR1 may play an important role in cell migration and cytoskeleton remodeling PMID: 22199287 Ror1 undergoes complex post-translational modifications by glycosylation and mono-ubiquitination. These modifications regulate Ror1 localization and signalling, and are highly variable among individual chronic lymphocytic leukemia patients. PMID: 21481194 ROR1 is uniformly and highly expressed in all in chronic lymphocytic leukemia (CLL) cases at initial diagnosis and can serve as a diagnostic tool. PMID: 21531460 ROR1 is expressed on hematogones (non-neoplastic human B-lymphocyte precursors) and a minority of precursor-B acute lymphoblastic leukemia. PMID: 21813176 A panel of mAbs demonstrated high affinity and specificity for a diverse set of epitopes that involve all three extracellular domains of ROR1, are accessible on the cell surface, and mediate internalization PMID: 21698301 Show More Hide All
Involvement in disease	Deafness, autosomal recessive, 108 (DFNB108)
Subcellular Location	Membrane, Single-pass type I membrane protein, Cell projection, axon
Protein Families	Protein kinase superfamily, Tyr protein kinase family, ROR subfamily
Tissue Specificity	Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Database Links	HGNC: 10256 OMIM: 602336 KEGG: hsa:4919 STRING: 9606.ENSP00000360120 UniGene: Hs.128753

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP020067HU1d7
Size	$468
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/ml can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC₅₀ is 0.2450-0.3416 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage