Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP020067HU |
| Product Type | Recombinant Protein |
| Size |
US$2010Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | Q01973 |
| Lead Time | 3-7 business days |
| Relevance | Tyrosine-protein kinase receptor whose role is not yet clear. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Neurotrophic tyrosine kinase, receptor-related 1 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC |
| Research Area | Neuroscience |
| Source | Yeast |
| Gene Names | ROR1 |
| Protein Names | Recommended name: Tyrosine-protein kinase transmembrane receptor ROR1 EC= 2.7.10.1 Alternative name(s): Neurotrophic tyrosine kinase, receptor-related 1 |
| Expression Region | 30-391aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 42.6kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo |
| Involvement in disease | Deafness, autosomal recessive, 108 (DFNB108) |
| Subcellular Location | Membrane, Single-pass type I membrane protein, Cell projection, axon |
| Protein Families | Protein kinase superfamily, Tyr protein kinase family, ROR subfamily |
| Tissue Specificity | Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm. |
| Database Links |
HGNC: 10256 OMIM: 602336 KEGG: hsa:4919 STRING: 9606.ENSP00000360120 UniGene: Hs.128753 |
ROR1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA020067LC01HU | ROR1 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA020067LA01HU | ROR1 Antibody | Human | ELISA, IHC |
| CSB-PA020067LD01HU | ROR1 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA020067LB01HU | ROR1 Antibody, HRP conjugated | Human | ELISA |
ROR1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA020067GA01HU | ROR1 Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA067964 | ROR1 Antibody | Human,Mouse | ELISA,IHC |
| CSB-PA993257 | ROR1 Antibody | Human,Mouse | ELISA,IHC |
ROR1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP020067HU | Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial | E.coli |
| CSB-MP020067HU |
Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1) | Mammalian cell |
Recombinant Human Peroxisome prolifeRator-activated receptor gamma(PPARG)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase(LIPA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial
Express system: E.coli
Species: Homo sapiens (Human)
-AC.jpg)
Recombinant Human Aquaporin-1(AQP1) (Active)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human Junctional adhesion molecule B(JAM2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Alpha-2-macroglobulin(A2m),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
