Code | CSB-YP020067HU |
Size |
US$2010Purchase it in Cusabio online store (only available for customers from the US) |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | ROR1 |
Uniprot No. | Q01973 |
Research Area | Neuroscience |
Alternative Names | Neurotrophic tyrosine kinase, receptor-related 1 |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 30-391aa |
Target Protein Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 42.6kDa |
Protein Length | Extracellular Domain |
Tag Info | N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo |
Involvement in disease | Deafness, autosomal recessive, 108 (DFNB108) |
Subcellular Location | Membrane, Single-pass type I membrane protein, Cell projection, axon |
Protein Families | Protein kinase superfamily, Tyr protein kinase family, ROR subfamily |
Tissue Specificity | Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm. |
Database Links |
HGNC: 10256 OMIM: 602336 KEGG: hsa:4919 STRING: 9606.ENSP00000360120 UniGene: Hs.128753 |
Recombinant Cupressus arizonica Pectate lyase 1
Express system: E.coli
Species: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)
Recombinant Human X-ray repair cross-complementing protein 5(XRCC5),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Protein phosphatase 1A(PPM1A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Elongation factor Tu, mitochondrial(TUFM)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Casein kinase I isoform epsilon(CSNK1E)
Express system: E.coli
Species: Homo sapiens (Human)