Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

In Stock
Code CSB-YP020067HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q01973
Lead Time 3-7 business days
Relevance Tyrosine-protein kinase receptor whose role is not yet clear.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Neurotrophic tyrosine kinase, receptor-related 1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC
Research Area Neuroscience
Source Yeast
Gene Names ROR1
Protein Names Recommended name: Tyrosine-protein kinase transmembrane receptor ROR1 EC= 2.7.10.1 Alternative name(s): Neurotrophic tyrosine kinase, receptor-related 1
Expression Region 30-391aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 42.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo
Involvement in disease Deafness, autosomal recessive, 108 (DFNB108)
Subcellular Location Membrane, Single-pass type I membrane protein, Cell projection, axon
Protein Families Protein kinase superfamily, Tyr protein kinase family, ROR subfamily
Tissue Specificity Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Database Links

HGNC: 10256

OMIM: 602336

KEGG: hsa:4919

STRING: 9606.ENSP00000360120

UniGene: Hs.128753

Related Products

ROR1 Antibodies

ROR1 Antibodies for Human

ROR1 Antibodies for Homo sapiens (Human)

ROR1 Proteins

ROR1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.