Home
Active Protein
Other
Recombinant Macaca mulatta C-C motif chemokine 17 (CCL17) (Active)

Recombinant Macaca mulatta C-C motif chemokine 17 (CCL17) (Active)

^{In Stock} ^Promotion

Code	CSB-MP811562MOW
Abbreviation	Recombinant Rhesus macaque CCL17 protein (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Promotion
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/ml can bind Macaca mulatta CCL17 protein. The EC₅₀ is 1.953-2.469 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/mL can bind Macaca mulatta CCL17 protein. The EC50 is 1.953-2.469 ng/mL.

Target Names

CCL17

Uniprot No.

Q8HYP9

Alternative Names

C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; CCL17; TARC

Species

Macaca mulatta (Rhesus macaque)

Source

Mammalian cell

Expression Region

24-94aa

Target Protein Sequence

ARGTNVGRECCLKYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQNKAICSDPNDKKVKKALKYLQSLERS

Mol. Weight

37.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal mFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.

Subcellular Location

Secreted.

Protein Families

Intercrine beta (chemokine CC) family

Database Links

KEGG: mcc:574180

STRING: 9544.ENSMMUP00000023940

UniGene: Mmu.3705

Promotions