Recombinant Mouse Cell division control protein 42 homolog (Cdc42)

In Stock
Code CSB-EP005008MO
Abbreviation Recombinant Mouse Cdc42 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
G25K GTP-binding protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-188aa
Target Protein Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In its active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Regulates cell migration. In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections. Required for DOCK10-mediated spine formation in Purkinje cells and hippocampal neurons. Facilitates filopodia formation upon DOCK11-activation. Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling. Also plays a role in phagocytosis through organization of the F-actin cytoskeleton associated with forming phagocytic cups.
Gene References into Functions
  1. We concluded that CDC42 negatively regulates SEPT12 polymerization and is involved in terminal structure formation of sperm heads. PMID: 30189608
  2. These results of this study suggest that Cdc42 and Rac1 synergistically function in BG during cerebellar corticogenesis. PMID: 29253508
  3. Cdc42 deficiency impairs endothelial cell function and regeneration after inflammatory vascular injury. PMID: 29422044
  4. MiR-7 inhibited peripheral nerve injury repair by affecting neural stem cells migration and proliferation through cdc42. PMID: 29663842
  5. downregulation of Cdc42, but not Rac1, is responsible for the unusual biophysical features of tumor repopulating cells. PMID: 29673588
  6. Rac1 and Cdc42 have cooperating roles in regulation of bone development. PMID: 29626467
  7. results suggest epithelium cell-specific Cdc42 deletion leads to tooth hypomaturation and transformation of the enamel prism structure that is likely due to altered ameloblast morphology and the secretion of enamel matrix proteins and proteases. This is the first in vivo evidence suggesting that Cdc42 is essential for proper tooth development and amelogenesis. PMID: 29684584
  8. Although much of the basic actin machinery was intact, Cdc42 null cells lacked the ability to polarize their Golgi and coordinate motility systems for efficient movement. Loss of Cdc42 de-coupled three main systems: actin assembly via the formin FMNL2 and Arp2/3, active myosin-II localization, and integrin-based adhesion dynamics. PMID: 28238662
  9. Cdc42 is required for endothelial tip cell selection, directed cell migration and filopodia formation, but dispensable for cell proliferation or apoptosis. Although the loss of Cdc42 seems generally compatible with apical-basal polarization and lumen formation in retinal blood vessels PMID: 29853619
  10. Cdc42 bypasses the need for exogenous fibronectin by stimulating cellular fibronectin deposition under the newly formed lamellipodia. PMID: 28754687
  11. Simulated microgravity activates Cdc42 via Rap1GDS1 to promote vascular branch morphogenesis. PMID: 29145128
  12. In contrast to neuronal cells, Botulinum neurotoxin type B uses a Cdc42-dependent pathway to enter intestinal cells. PMID: 28296078
  13. We conclude that CRN7 spatiotemporally influences F-actin organization and Golgi integrity in a Cdc42- and N-WASP-dependent manner. PMID: 27143109
  14. the expression of CDC42 might be regulated by AHR, and both proteins are fundamental to the development of normal spermatozoa and the acrosome reaction. PMID: 27635527
  15. CDC42 loss suppresses acute myeloid leukemia cell polarity and division asymmetry. PMID: 28778865
  16. CDC42 is involved in the trafficking of FGF receptors to the cell membrane to regulate epicardium formation. PMID: 28465335
  17. LRCH1 as a novel effector to restrain PKCalpha-DOCK8-Cdc42 module-induced T cell migration and ameliorate experimental autoimmune encephalomyelitis (EAE). PMID: 28028151
  18. analysis of phenotypes of Cdc42 and Myo10 deletion that show multiple roles of filopodial dynamics PMID: 28289096
  19. Finally, we demonstrate that Cdc42 is involved in neuroligin-dependent presynaptic differentiation of proprioceptive sensory neurons in vitro These data suggest that Cdc42 in presynaptic sensory neurons is essential for proper synapse formation in the development of monosynaptic sensory-motor circuits. PMID: 27225763
  20. found that DOCK8 associated with LRAP35a, an adaptor molecule that binds to the Cdc42 effector myotonic dystrophy kinase-related Cdc42-binding kinase, and facilitated its activity to phosphorylate myosin II regulatory light chain PMID: 28028174
  21. These results indicate that HuR promotes early intestinal mucosal repair after injury by increasing Cdc42 translation. PMID: 28031329
  22. Lrrk1 deficiency in osteoclasts resulted in reduced phosphorylation and activation of RAC1/Cdc42 PMID: 27600824
  23. Akt3 constitutively suppresses macropinocytosis in macrophages through a novel WNK1/SGK1/Cdc42 pathway. PMID: 28389565
  24. Cdc42 is essential for cardiomyocyte proliferation, sarcomere organization and cell-cell adhesion during heart development. PMID: 27986432
  25. Cdc42 is involved not in osteogenesis but in chondrogenesis in which the BMP2/Cdc42/Pak/p38/Smad signaling module promotes mesenchymal condensation and the TGF-beta/Cdc42/Pak/Akt/Sox9 signaling module facilitates chondrogenic differentiation. PMID: 26739452
  26. These data show that membrane protrusions originate from surface ectodermal cells and that Rac1 is necessary for the formation of membrane ruffles which typify late neural fold closure stages, whereas Cdc42 is required for the predominance of filopodia in early neurulation. PMID: 27114066
  27. findings demonstrate that Cdc42 plays essential roles in mammary gland function post pregnancy, where it helps to establish proper epithelial cell polarity and tissue homeostasis during lactation. PMID: 26912661
  28. This work demonstrated miR-137 and CDC42 are critical regulators in cardiomyocyte apoptosis. PMID: 26566162
  29. the principal role of Cdc42 in ureteric bud and metanephric mesenchyme development is to regulate epithelial cell polarity and the actin cytoskeleton. PMID: 26490995
  30. indicate that restricted expression of Wnt5a in the caudal SpM is essential for normal OFT morphogenesis, and uncover a novel function of spatially regulated cell cohesion by Wnt5a in driving the deployment of SHF cells from the SpM into the OFT PMID: 26902112
  31. role of P-cadherin through beta-PIX-mediated Cdc42 activation in the regulation of cell polarity PMID: 26783302
  32. Thus, Cdc42 and Rac1 have nonredundant roles in controlling ALK-rearranged lymphoma survival and morphology but are redundant for lymphoma dissemination PMID: 26747246
  33. Knockdown of Fat1 in renal tubular cells decreases active RAC1 and CDC42. PMID: 26905694
  34. Our findings demonstrate the importance of Cdc42 for cartilage development during both embryonic and postnatal stages. PMID: 26820532
  35. Data indicate enantiomer selective interaction of R-naproxen and R-ketorolac with Rho family GTPases Rac1 and Cdc42. PMID: 26558612
  36. results indicate that there is a crucial role for 5-HT7R-Cdc42-mediated signaling in the regulation of dendritic cell morphology and motility, suggesting that 5-HT7R could be a new target for treatment of a variety of inflammatory and immune disorders. PMID: 26092936
  37. Axin promotes dendritic spine stabilization through Cdc42-dependent cytoskeletal reorganization. PMID: 26204446
  38. NRP1 enables the extracellular matrix (ECM)-induced activation of CDC42, a key regulator of filopodia formation. PMID: 26051942
  39. Cdc42 control of actin dynamics keeps DCs in an immature state. PMID: 26553928
  40. to become apically clustered, Cdc42 requires the interaction between its polybasic region and negatively charged membrane lipids provided by ATP8B1. PMID: 26416959
  41. This work supports the notion of Cdc42 as a central regulator of the cellular machinery in endothelial cells that drives blood vessel formation. PMID: 26253403
  42. Results provide novel evidence that low expression of SLIT2 correlates with poor prognosis and promotes metastasis in ESCC, which may be regulated by the Cdc42-mediated pathways. PMID: 25490006
  43. deletion of Cdc42 impaired LTP in the Schaffer collateral synapses and postsynaptic structural plasticity of dendritic spines in CA1 pyramidal neurons; loss of Cdc42 did not affect memory acquisition, but instead impaired remote memory recall PMID: 25006034
  44. Our results demonstrate a critical role for Cdc42 in the motility of mature B cells, their cognate interaction with T cells, and their differentiation into Ab-producing cells PMID: 25870239
  45. PAK4 phosphorylates Par6B at Ser143 blocking its interaction with Cdc42. PMID: 25662318
  46. Data indicate cell division cycle 42 protein (Cdc42) as key regulator of B cell physiology. PMID: 25547673
  47. CDC42 has a crucial role in senescence-associated inflammation and atherosclerosis. PMID: 25057989
  48. demonstrate that constitutively-active Cdc42 binding to gammaCOP induced the accumulation of epithelial growth factor receptor (EGFR) in the cells PMID: 25497016
  49. It was concluded that Cdc42 is essential for cartilage development during endochondral bone formation. PMID: 25343271
  50. findings demonstrate that dual lipidation of Cdc42-palm represents an important regulator of morphogenic signalling in hippocampal neurons. PMID: 24059268

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Cytoplasm. Cell projection, lamellipodium membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, dendrite.
Protein Families
Small GTPase superfamily, Rho family, CDC42 subfamily
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*