Recombinant Mouse Tyrosine-protein kinase JAK3 (Jak3), partial

Code CSB-YP717252MO
Abbreviation Recombinant Mouse Jak3 protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
Jak3; Tyrosine-protein kinase JAK3; EC 2.7.10.2; Janus kinase 3; JAK-3
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
818-1100aa
Target Protein Sequence
LKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.
Gene References into Functions
  1. Study investigated the effect of Jak3 signaling on differentiation from nestin progenitor cells using E13.5 spinal progenitor cell cultures. Results indicated that neuronal and microglial cell differentiation was regulated primarily by Jak3 signaling and the developing neurons and neurite outgrowth might also be regulated by Jak3-dependent microglial activity. PMID: 28817455
  2. JAK3 up-regulates SGLT1 activity by increasing the carrier protein abundance in the cell membrane, an effect enforcing cellular glucose uptake into activated lymphocytes and thus contributing to the immune response. PMID: 27595398
  3. Foxp3 has a rapid turn over in Treg partly controlled at the transcriptional level by the JAK/STAT pathway PMID: 27077371
  4. JAK3 contributes to the regulation of membrane Kv1.5 protein abundance and activity, an effect sensitive to ouabain and thus possibly involving Na(+)/K(+) ATPase activity. PMID: 26100849
  5. JAK3 deficiency is followed by down-regulation of cytosolic Ca(2+) release, receptor and store operated Ca(2+) entry and Na(+)/Ca(2+) exchanger activity in dendritic cells. PMID: 26279433
  6. Jak3 has a role in promoting mucosal tolerance through suppressed expression and limiting activation of TLRs thereby preventing intestinal and systemic chronic low-grade inflammation and associated obesity and MetS PMID: 26451047
  7. Our results demonstrate that JAK3/STAT6 has an important role in bone marrow-derived fibroblast activation, extracellular matrix production, and interstitial fibrosis development. PMID: 26032813
  8. results showed that different JAK3 mutations induce constitutive activation through distinct mechanisms, pointing to specific therapeutic perspectives PMID: 26446793
  9. JAK3 down-regulates Na(+)/K(+)-ATPase activity, an effect involving gene expression and profoundly curtailing ATP consumption. PMID: 26021261
  10. In conclusion, JAK3 deficiency leads to increased formation of calcitriol, which contributes to or even accounts for increased release of FGF23 and enhanced intestinal phosphate absorption. PMID: 25493954
  11. JAK3 deficiency leads to intestinal sodium (Na+) loss, decrease of blood pressure, increased aldosterone release and subsequent stimulation of renal tubular Na(+) reabsorption. PMID: 24281140
  12. JAK3 is a powerful regulator of the peptide transporters PEPT1 and PEPT2. PMID: 23934551
  13. cPLA2, p38 mitogen-activated protein kinase (MAPK), and Janus kinase 3 (JAK3) signaling are necessary for F. tularensis-induced PGE2 production. PMID: 24343645
  14. the essential role of Jak3 in the colon where it facilitated mucosal differentiation by promoting the expression of differentiation markers and enhanced colonic barrier functions through AJ localization of beta-catenin. PMID: 24045942
  15. The potential effects of pharmacological JAK3 inhibition in a myocardial ischemia and reperfusion injury model, were investigated. PMID: 23680658
  16. Inhibition of JAK3 suppressed phosphorylation of PI3K downstream effectors including Akt, mammalian target of rapamycin complex 1, glycogen synthase kinase 3beta, and CREB. JAK3 differentially regulates TLR-mediated inflammatory cytokine production. PMID: 23797672
  17. hemagglutinin of H5N1 avian influenza triggered an abnormal innate immune signalling in the pulmonary epithelial cells, through an unusual process involving activation of Janus kinase 3 PMID: 22359619
  18. analysis of the biochemistry, immunological functions, and clinical significance of JAK3 [review] PMID: 22130498
  19. These findings highlight the pathological role of CD8(+) T cells and Jak3-dependent IFN-gamma-mediated Th1 responses in cerebral malaria pathogenesis. PMID: 22363534
  20. JAK3 inhibition potently facilitates myoblast differentiation through antagonistic STAT1/STAT3 activities. PMID: 22120524
  21. dominant-negative mutants of either Cullin1 or Cullin5, which lack the C terminus responsible for recruiting the E2 enzymes, were able to prevent JAK3 degradation induced by both ASB2/SKP2 and NOTCH signaling. PMID: 21969365
  22. This study defines a novel JAK3 mutation among patients with N-DS AML and demonstrates that normal individuals can also display germline JAK3 substitutions, previously proven to have oncogenic properties, in vitro and in vivo. PMID: 21599579
  23. Janus kinase 3 is expressed in erythrocytes, phosphorylated upon energy depletion and involved in the regulation of suicidal erythrocyte death. PMID: 21691072
  24. Human cord blood-derived CD34+ hematopoietic stem cells were successfully engrafted into Balb/c Rag-2-/-Jak3-/- mice; however, the engraftment rate was far lower in C57/BL6 Rag-2-/-Jak3-/- mice. PMID: 21331358
  25. Jak3 inhibition induced neuronal differentiation accompanied by neurite growth. PMID: 20979137
  26. the CD69 cytoplasmic tail associates with the Jak3/Stat5 signaling pathway, which regulates the transcription of RORgammat and, consequently, differentiation toward the Th17 lineage PMID: 20696842
  27. despite its dependence on leukemia inhibitory factor, JAK3 is not essential for LIF-mediated photoreceptor protection or gene expression. PMID: 20345762
  28. Jak3 is important for dendritic cell maturation, migration and function, through a CCR7-mediated signalling pathway PMID: 19759904
  29. Nonhematopoietic expression of Janus kinase 3 is required for eosinophilic airway inflammation PMID: 11859141
  30. plays several important roles in B cells: during development, to enable cell division, Ig gene rearrangement and cell differentiation, and in mature cells, to promote B cell survival in the periphery PMID: 12147626
  31. Activation of this pathway is associated with granulocytic differentiation of myeloid precursor cells PMID: 12351382
  32. observations establish JAK3 as a key mediator of severe GVHD after allogeneic BMT in the context of a major-HLA disparity PMID: 12389628
  33. Jak3 is a primary response gene for interleukin-6 in macrophage differentiation, and ectopic overexpression of Jak3 accelerates monocytic differentiation of normal mouse bone marrow cells stimulated with cytokines PMID: 14976041
  34. Jak3 is not essential for dendritic cell development but unexpectedly appears to be an important negative regulator PMID: 16020505
  35. the effect of IL-15 and IL-21, which are closely related to IL-2 and share the usage of the common gamma chain and of its JAK3-associated pathway. PMID: 17938255
  36. PDGFRalpha and JAK3 have roles in Galpha(12)-mediated cell proliferation PMID: 18038259
  37. The efficacy observed with CP-690550 in collagen-induced arthritis and adjuvant arthritis suggests JAK3 inhibition may represent novel therapeutic target for treatment of rheumatoid arthritis. PMID: 18234077
  38. data indicate that Janus-kinase-3 regulates epigenetic modification and chromatin remodeling of the Ifng locus during Th1 cell differentiation PMID: 18549798
  39. somatic loss of BLNK and concomitant mutations leading to constitutive activation of Jak3/STAT5 pathway result in the generation of pre-B-cell leukemia PMID: 19047679
  40. functions of JAK3 in the development of skin immune responses and diseases such as psoriasis PMID: 19596999

Show More

Hide All

Subcellular Location
Endomembrane system; Peripheral membrane protein. Cytoplasm.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Tissue Specificity
In contrast with the ubiquitous expression of the other JAKs, JAK3 is predominantly expressed in hematopoietic tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*