Recombinant Pig Coagulation factor XII (F12), partial

In Stock
Code CSB-EP007918PI
Abbreviation Recombinant Pig F12 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
F12Coagulation factor XII; EC 3.4.21.38; Hageman factor; HAF) [Cleaved into: Coagulation factor XIIa heavy chain; Coagulation factor XIIa light chain]
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
20-371aa
Target Protein Sequence
IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pig Coagulation factor XII (F12) is produced in an E.coli expression system, featuring a partial protein length from amino acids 20 to 371. The protein carries an N-terminal 6xHis tag, which streamlines purification and detection processes. SDS-PAGE analysis confirms the product achieves over 90% purity, making it appropriate for research applications. This product is intended for research use only.

Coagulation factor XII represents a crucial component of the coagulation cascade. It appears to primarily drive the initiation of the intrinsic pathway. This serine protease likely plays a significant role in hemostasis by activating factor XI and prekallikrein. Studying this factor may be important for understanding blood clotting disorders and developing therapeutic interventions. Many researchers turn to factor XII when investigating thrombosis and inflammation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The porcine factor XII is a complex serine protease zymogen whose bioactivity critically depends on correct tertiary structure formation, including specific disulfide bond patterns and potential glycosylation modifications. E. coli, as a prokaryotic expression system, lacks the eukaryotic chaperones and post-translational modification machinery necessary for proper folding of complex plasma proteins. While the partial sequence (20-371aa) may contain protease domains, independent expression in E. coli is highly unlikely to yield a correctly folded, bioactive protein due to the absence of proper disulfide bond formation and glycosylation.

1. Antibody Development and Validation

This recombinant protein can be used as an immunogen to generate antibodies against porcine F12, as antibodies can recognize linear epitopes. The high purity helps minimize antibodies against contaminants. However, antibodies produced may not recognize native, correctly folded F12 (e.g., in porcine plasma) due to altered conformational epitopes. Antibody specificity must be validated using native F12 purified from porcine plasma before applications like Western blot or ELISA.

2. Biochemical Characterization and Structural Analysis

The protein is suitable for basic biophysical characterization (e.g., circular dichroism for secondary structure, dynamic light scattering for aggregation state). Such studies are valuable for understanding the folding challenges encountered during E. coli expression. However, it is not suitable for high-resolution structural studies (e.g., X-ray crystallography) aimed at understanding the structure-function relationship of native F12.

3. Comparative Species Analysis

This protein can be used to compare physicochemical properties (e.g., molecular weight, theoretical pI, thermal stability) with F12 from other species. However, because it is likely misfolded, any comparison of functional properties (e.g., enzymatic activity, substrate specificity) is invalid. Meaningful cross-species functional comparisons require bioactive protein samples.

Final Recommendation & Action Plan

Given the structural complexity of Factor XII and the limitations of the E. coli expression system, this recombinant protein is highly unlikely to be bioactive and must not be used for functional studies (e.g., coagulation assays or interaction studies). The first step is to experimentally assess its folding state using techniques like non-reducing SDS-PAGE or Ellman's assay to check disulfide bond formation, and circular dichroism to analyze secondary structure. If misfolding is confirmed, its only reliable application is as an immunogen for antibody production, but resulting antibodies must be rigorously validated against native F12. For any research requiring functional F12, alternative expression in mammalian systems (e.g., HEK293 or CHO cells) is strongly recommended to obtain properly folded and modified protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa.
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*