Name: Recombinant Human B-cell antigen receptor complex-associated protein alpha chain(CD79A)
Brand: CUSABIO
SKU: CSB-CF004957HU

Product Details

Target Names	CD79A
Uniprot No.	P11912
Alternative Names	B lymphocyte-specific MB1 protein; B-cell antigen receptor complex-associated protein alpha chain; CD 79a; CD79a; CD79a antigen (immunoglobulin-associated alpha); CD79A antigen; CD79a molecule; immunoglobulin-associated alpha; CD79A_HUMAN; Ig alpha; Ig-alpha; IGA; IgM-alpha; Immunoglobulin-associated alpha; Ly54; MB-1 membrane glycoprotein; MB1; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein
Species	Homo sapiens (Human)
Expression Region	33-226
Target Protein Sequence	LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Protein Length	Full Length of Mature Protein
Tag Info	The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form	Lyophilized powder
Buffer before Lyophilization	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function	Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions	The incidence of MYD88 and CD79B mutations in patients with CD5(+) DLBCL is lower than that in patients with DLBCL-SS, suggesting that CD5(+) DLBCL is not the same disease as DLBCL-SS in terms of gene mutation status. PMID: 27915469 Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part. PMID: 24769851 High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase. PMID: 24974109 CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy. PMID: 24146823 STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL. PMID: 21324920 CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401 Unlike the B29 octamer motif, the mb-1 octamer motif does not have the essential sequence required for OBF-1/Bob1 interaction, therefore its promoter is not transactivated by OBF-1/Bob1. PMID: 11907094 B cell-restricted mb-1 gene: expression, function, and lineage infidelity. Review. PMID: 12403343 There is a somatic hypermutation of this gene in B-cell lymphoma and multiple myeloma. PMID: 12651942 Results indicate that PAX5 is a more specific marker than CD79a for B-cell ALL diagnosis. PMID: 15492262 lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains. PMID: 15591116 FISH findings indicate that CD79a, despite its specificity for B-cell differentiation, represented the aberrant presence of a B-cell antigen in leukemias of distinct myeloid linage. PMID: 16271957 Acute leukemia with t(8;21) coexpresses CytCD79a represent biphenotypic acute leukemia. PMID: 17350472 Anti-CD79b antibodies downregulated surface B-cell receptor and were trafficked to the lysosomal-like major histocompatibility complex class II-positive compartment of a mouse xenograft model of non-Hodgkin lymphoma. PMID: 17374736 Ig-alpha was phosphorylated in all myeloma IgG BCR isolates, the 31-kD variant being phosphorylated most frequently. It was not phosphorylated in normal control B cells. PMID: 17701175 Median survival time of cytoplasmic CD79 alpha positive group was shorter than that of cytCD79a negative group in acute myeloid leukemia. PMID: 18160827 Show More Hide All
Involvement in disease	Agammaglobulinemia 3, autosomal recessive (AGM3)
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	B-cells.
Database Links	HGNC: 1698 OMIM: 112205 KEGG: hsa:973 STRING: 9606.ENSP00000221972 UniGene: Hs.631567

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-CF004957HU
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human B-cell antigen receptor complex-associated protein alpha chain(CD79A)

Product Details

Related Products

Customer Reviews and Q&A

Target Data

CloseMessage

×CloseMessage