Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)

In Stock
Code CSB-MP004957HU1p6
Abbreviation Recombinant Human CD79A protein, partial (Active)
MSDS
Size $138
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 14.44-16.80 ng/mL.
Target Names
Uniprot No.
Alternative Names
B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-143aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Mol. Weight
41.3 kDa
Protein Length
Partial
Tag Info
C-terminal mFc-Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

A DNA fragment corresponding to the human CD79A (33-143aa) was expressed with a mFC-flag tag at the C-terminus in mammalian cells. The product is the recombinant human CD79A protein. It carries a C-terminal mFC-flag-tag. Its purity is greater than 95% as measured by SDS-PAGE. Its endotoxin is less than 1.0 EU/ug as determined by the LAL method. In a functional ELISA, this recombinant CD79A protein is validated to be biologically active as it can bind to the anti-CD79A recombinant antibody(CSB-RA004957MA1HU), with the EC50 of 14.44-16.80 ng/mL.

The CD79A protein plays a crucial role in B-cell biology, primarily functioning as an integral component of the B-cell receptor (BCR) complex. CD79A is essential for B-cell development, differentiation, and activation upon antigen binding, which is critical for the adaptive immune response. CD79A, along with its partner CD79B, forms a heterodimer that transmits signals from the BCR to intracellular signaling pathways, thereby facilitating B-cell activation and proliferation [1][2].

During the early stages of B-cell development, CD79A is expressed in nearly all B-cell stages, from pro-B cells to mature B cells, and its expression diminishes in plasma cells [3][4]. This expression pattern highlights its role as a pan-cell marker for B-lineage assignment, making it a valuable tool in the characterization of B-cell malignancies [3]. Furthermore, CD79A is implicated in tonic signaling, which is a continuous low-level signaling necessary for the survival and maintenance of mature B cells [5][6]. The tonic signaling is crucial for the development of mature follicular B cells and has been shown to influence the progression of various B-cell malignancies, including diffuse large B-cell lymphoma (DLBCL) [1][7].

In the context of cancer, CD79A has been identified as a significant factor in the prognosis of several B-cell neoplasms. High expression levels of CD79A are associated with poorer outcomes in classical Hodgkin's lymphoma and other B-cell malignancies, indicating its potential as a therapeutic target [8][9]. In pediatric B-cell precursor acute lymphoblastic leukemia (BCP-ALL), CD79A is crucial for CNS infiltration and leukemia engraftment, underscoring its role in tumor biology and metastasis [10]. Moreover, mutations in the CD79A gene have been linked to enhanced BCR signaling, contributing to the pathogenesis of aggressive forms of DLBCL [2][7].

Additionally, CD79A's role extends beyond B-cell activation to include interactions with myeloid cells, where it can influence immune responses and tumor microenvironments. CD79A expression on myeloid-derived suppressor cells (MDSCs) has been shown to enhance their immunosuppressive capabilities, promoting tumor growth [11]. This multifaceted role of CD79A in both normal B-cell physiology and in the context of malignancy highlights its importance as a target for therapeutic interventions aimed at modulating immune responses and treating B-cell-related diseases.

References:
[1] V. Xiao. Discovery of novel targets for diffuse large b-cell lymphoma, J Emerg Invest, 2021. https://doi.org/10.59720/21-102
[2] O. Ducharme, M. Beylot‐Barry, A. Pham‐Ledard, É. Bohers, P. Viailly, T. Bandres, et al. Mutations of the b-cell receptor pathway confer chemoresistance in primary cutaneous diffuse large b-cell lymphoma leg type, Journal of Investigative Dermatology, vol. 139, no. 11, p. 2334-2342.e8, 2019. https://doi.org/10.1016/j.jid.2019.05.008
[3] A. Berhili, M. Bensalah, J. Elmalki, A. Elyagoubi, & R. Seddik. Immunophenotypic challenges in diagnosis of cd79a negativity in a patient with b acute lymphoblastic leukemia harboring intrachromosomal amplification of chromosome 21: a case report, Journal of Medical Case Reports, vol. 15, no. 1, 2021. https://doi.org/10.1186/s13256-021-03128-2
[4] S. Sirivisoot, S. Techangamsuwan, S. Tangkawattana, & A. Rungsipipat. Pax5 as a potential candidate marker for canine b-cell lymphoma, Veterinární Medicína, vol. 62, no. 2, p. 74-80, 2017. https://doi.org/10.17221/100/2016-vetmed
[5] X. Huang, K. Takata, Y. Sato, T. Tanaka, K. Ichimura, M. Tamura, et al. Downregulation of the b‐cell receptor signaling component cd79b in plasma cell myeloma: a possible post transcriptional regulation, Pathology International, vol. 61, no. 3, p. 122-129, 2011. https://doi.org/10.1111/j.1440-1827.2010.02634.x
[6] J. Müller-Winkler, R. Mitter, J. Rappe, L. Vanes, E. Schweighoffer, H. Mohammadi, et al. Critical requirement for bcr, baff, and baffr in memory b cell survival, The Journal of Experimental Medicine, vol. 218, no. 2, 2020. https://doi.org/10.1084/jem.20191393
[7] O. Havránek, J. Xu, S. Köhrer, Z. Wang, L. Becker, J. Comer, et al. Tonic b-cell receptor signaling in diffuse large b-cell lymphoma, Blood, vol. 130, no. 8, p. 995-1006, 2017. https://doi.org/10.1182/blood-2016-10-747303
[8] S. Yao, Z. Huang, C. Wei, Y. Wang, H. Xiao, S. Chen, et al. Cd79a work as a potential target for the prognosis of patients with oscc: analysis of immune cell infiltration in oral squamous cell carcinoma based on the cibersortx deconvolution algorithm, BMC Oral Health, vol. 23, no. 1, 2023. https://doi.org/10.1186/s12903-023-02936-w
[9] S. Yao, Z. Huang, C. Wei, Y. Wang, H. Xiao, S. Chen, et al. Cd79a work as a potential target for the prognosis of patients with hnscc: analysis of immune cell infiltration in head and neck squamous cell carcinoma based on the cibersortx deconvolution algorithm,, 2022. https://doi.org/10.21203/rs.3.rs-2177047/v1
[10] L. Lenk, M. Carlet, F. Vogiatzi, L. Spory, D. Winterberg, A. Cousins, et al. Cd79a promotes cns-infiltration and leukemia engraftment in pediatric b-cell precursor acute lymphoblastic leukemia, Communications Biology, vol. 4, no. 1, 2021. https://doi.org/10.1038/s42003-020-01591-z
[11] D. Luger, Y. Yang, A. Raviv, D. Weinberg, S. Banerjee, M. Lee, et al. Expression of the b-cell receptor component cd79a on immature myeloid cells contributes to their tumor promoting effects, Plos One, vol. 8, no. 10, p. e76115, 2013. https://doi.org/10.1371/journal.pone.0076115

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions
  1. The incidence of MYD88 and CD79B mutations in patients with CD5(+) DLBCL is lower than that in patients with DLBCL-SS, suggesting that CD5(+) DLBCL is not the same disease as DLBCL-SS in terms of gene mutation status. PMID: 27915469
  2. Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part. PMID: 24769851
  3. High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase. PMID: 24974109
  4. CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy. PMID: 24146823
  5. STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL. PMID: 21324920
  6. CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401
  7. Unlike the B29 octamer motif, the mb-1 octamer motif does not have the essential sequence required for OBF-1/Bob1 interaction, therefore its promoter is not transactivated by OBF-1/Bob1. PMID: 11907094
  8. B cell-restricted mb-1 gene: expression, function, and lineage infidelity. Review. PMID: 12403343
  9. There is a somatic hypermutation of this gene in B-cell lymphoma and multiple myeloma. PMID: 12651942
  10. Results indicate that PAX5 is a more specific marker than CD79a for B-cell ALL diagnosis. PMID: 15492262
  11. lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains. PMID: 15591116
  12. FISH findings indicate that CD79a, despite its specificity for B-cell differentiation, represented the aberrant presence of a B-cell antigen in leukemias of distinct myeloid linage. PMID: 16271957
  13. Acute leukemia with t(8;21) coexpresses CytCD79a represent biphenotypic acute leukemia. PMID: 17350472
  14. Anti-CD79b antibodies downregulated surface B-cell receptor and were trafficked to the lysosomal-like major histocompatibility complex class II-positive compartment of a mouse xenograft model of non-Hodgkin lymphoma. PMID: 17374736
  15. Ig-alpha was phosphorylated in all myeloma IgG BCR isolates, the 31-kD variant being phosphorylated most frequently. It was not phosphorylated in normal control B cells. PMID: 17701175
  16. Median survival time of cytoplasmic CD79 alpha positive group was shorter than that of cytCD79a negative group in acute myeloid leukemia. PMID: 18160827

Show More

Hide All

Involvement in disease
Agammaglobulinemia 3, autosomal recessive (AGM3)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
B-cells.
Database Links

HGNC: 1698

OMIM: 112205

KEGG: hsa:973

STRING: 9606.ENSP00000221972

UniGene: Hs.631567

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*