Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 1.521-1.700 ng/mL.

Target Names

CD79A

Uniprot No.

P11912

Alternative Names

B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

33-143aa

Target Protein Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

Mol. Weight

14.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD79A forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain proteins essential for antibody development workflows. This mammalian-expressed construct spanning residues 33–143 demonstrates quantifiable antibody-binding activity with an EC50 of 1.521–1.700 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody characterization. The mammalian expression system supports native glycosylation and disulfide bond formation critical for conformational epitope presentation, enabling accurate affinity measurements by surface plasmon resonance or biolayer interferometry in drug discovery campaigns targeting CD79A. With greater than 90% purity and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for ligand-binding assays and serves as a positive control in receptor-ligand interaction studies relevant to B-cell immunology and oncology research.

Target Background

Function

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.

Gene References into Functions

The incidence of MYD88 and CD79B mutations in patients with CD5(+) DLBCL is lower than that in patients with DLBCL-SS, suggesting that CD5(+) DLBCL is not the same disease as DLBCL-SS in terms of gene mutation status. PMID: 27915469
Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part. PMID: 24769851
High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase. PMID: 24974109
CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy. PMID: 24146823
STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL. PMID: 21324920
CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401
Unlike the B29 octamer motif, the mb-1 octamer motif does not have the essential sequence required for OBF-1/Bob1 interaction, therefore its promoter is not transactivated by OBF-1/Bob1. PMID: 11907094
B cell-restricted mb-1 gene: expression, function, and lineage infidelity. Review. PMID: 12403343
There is a somatic hypermutation of this gene in B-cell lymphoma and multiple myeloma. PMID: 12651942
Results indicate that PAX5 is a more specific marker than CD79a for B-cell ALL diagnosis. PMID: 15492262
lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains. PMID: 15591116
FISH findings indicate that CD79a, despite its specificity for B-cell differentiation, represented the aberrant presence of a B-cell antigen in leukemias of distinct myeloid linage. PMID: 16271957
Acute leukemia with t(8;21) coexpresses CytCD79a represent biphenotypic acute leukemia. PMID: 17350472
Anti-CD79b antibodies downregulated surface B-cell receptor and were trafficked to the lysosomal-like major histocompatibility complex class II-positive compartment of a mouse xenograft model of non-Hodgkin lymphoma. PMID: 17374736
Ig-alpha was phosphorylated in all myeloma IgG BCR isolates, the 31-kD variant being phosphorylated most frequently. It was not phosphorylated in normal control B cells. PMID: 17701175
Median survival time of cytoplasmic CD79 alpha positive group was shorter than that of cytCD79a negative group in acute myeloid leukemia. PMID: 18160827

Hide All

Involvement in disease

Agammaglobulinemia 3, autosomal recessive (AGM3)

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

B-cells.

Database Links

HGNC: 1698

OMIM: 112205

KEGG: hsa:973

STRING: 9606.ENSP00000221972

UniGene: Hs.631567

Code	CSB-MP004957HU1
Abbreviation	Recombinant Human CD79A protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC₅₀ is 1.521-1.700 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A）, partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage