Recombinant Mouse C-C chemokine receptor type 8(Ccr8)

Code CSB-CF004847MO
Size US$3470Purchase it in Cusabio online store
(only available for customers from the US)
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Ccr8
Uniprot No. P56484
Alternative Names Ccr8; Cmkbr8; Ter1; C-C chemokine receptor type 8; C-C CKR-8; CC-CKR-8; CCR-8; CD antigen CDw198
Species Mus musculus (Mouse)
Source in vitro E.coli expression system
Expression Region 1-353
Target Protein Sequence MDYTMEPNVTMTDYYPDFFTAPCDAEFLLRGSMLYLAILYCVLFVLGLLGNSLVILVLVG CKKLRSITDIYLLNLAASDLLFVLSIPFQTHNLLDQWVFGTAMCKVVSGLYYIGFFSSMF FITLMSVDRYLAIVHAVYAIKVRTASVGTALSLTVWLAAVTATIPLMVFYQVASEDGMLQ CFQFYEEQSLRWKLFTHFEINALGLLLPFAILLFCYVRILQQLRGCLNHNRTRAIKLVLT VVIVSLLFWVPFNVALFLTSLHDLHILDGCATRQRLALAIHVTEVISFTHCCVNPVIYAF IGEKFKKHLMDVFQKSCSHIFLYLGRQMPVGALERQLSSNQRSSHSSTLDDIL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length Full length protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the CCL1/SCY1/TCA-3 chemokine.
Gene References into Functions
  1. CCR8 negatively regulates migration of cutaneous dendritic cells from the skin to the draining lymph nodes in contact hypersensitivity by keeping these cells in the skin. PMID: 25344933
  2. Chemokine receptor CCR8 is required for lipopolysaccharide-triggered cytokine production in mouse peritoneal macrophages. PMID: 24714157
  3. A sustained donor Treg presence is critical for their beneficial properties, and that their survival depends on CCR8 and donor but not host CD11c(+) Aantigen presenting cells. PMID: 23798714
  4. Expression of CCR-8 in microglia was upregulated in the presence of CCL-1. PMID: 23747724
  5. C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity PMID: 22479563
  6. Hepatic macrophage migration and differentiation critical for liver fibrosis is mediated by the chemokine receptor C-C motif chemokine receptor 8 in mice. PMID: 22031018
  7. a key regulator of Th2 cell skin recruitment during IL-5-mediated allergic inflammation PMID: 21217759
  8. mediates increased responsiveness of murine eosinophils to TCA-3 PMID: 12050188
  9. Data from three different models plus an in vivo blocking study clearly show that the Th2 cell-mediated pathological response to ovalbumin-induced allergic airway inflammation is not critically CCR8-dependent. PMID: 12574386
  10. sulfation at specific positions of the N-terminal domain of mouse CCR8 is critical for its biological activity, whereas glycosylation has a minor influence PMID: 14736884
  11. IL-10 production correlates with CCR8 ligand (CCL1) expression and the appearance of CCR8+ cells in granulomatous lungs and is required for full expression of the T helper type 2 cell response to parasite antigens. PMID: 15699124
  12. CCR8 may have a negative impact on host defense during septic peritonitis, providing a new paradigm for the role of CCR8 in innate immunity. PMID: 16384913
  13. CCR8 ligands are allotropic, binding to distinct sites within CCR8 PMID: 17023422
  14. CCR8 is expressed by a small and heterogeneous population of peripheral blood CD4 memory T cells enriched in T helper type 2 (Th2) effector and T regulatory (Treg) cells. PMID: 17082609
  15. Ccr8 has a pivotal role in the progression of experimental fungal asthma. PMID: 17321573
  16. Mast cell-derived CCR8- and CCL1-expressing CD4-positive effector T lymphocytes play an essential role in orchestrating lung mucosal inflammatory responses. PMID: 17641040
  17. Results suggest that CCR8 plays a significant role in the pathogenesis of experimental autoimmune encephalomyelitis and probalby of multiple sclerosis. PMID: 17850582
  18. CCR8/CCL1 interaction may play a role in type 1 diabetes through macrophage recruitment and activation PMID: 17947648

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in thymus.
Database Links

KEGG: mmu:12776

STRING: 10090.ENSMUSP00000038473

UniGene: Mm.442098

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1