Recombinant Mouse T-cell-specific surface glycoprotein CD28 (Cd28)

Code CSB-CF004913MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cd28; T-cell-specific surface glycoprotein CD28; CD antigen CD28
Species
Mus musculus (Mouse)
Expression Region
20-218
Target Protein Sequence
NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Gene References into Functions
  1. CD28 may play a role in LPS nephropathy. Immunofluorescence colocalization analysis revealed a tight association of gammadeltaT cells with B7-1 in the kidney. High B7-1 expression was detected in podocytes treated with LPS. PMID: 29862277
  2. This work unravels a new regulatory mechanism for CD28 signaling that involves dynamic interplay between acidic phospholipids and Ca2+ to set the local electrostatic environment. PMID: 29058713
  3. CD28 signaling is required for follicular Treg cell differentiation. Treg-specific deletion of CD28 caused a reduction in TFR cell numbers and function, which resulted in increased germinal center B cells and Ab production. CD28-deficient TFR cells showed a diminished suppressive capacity. PMID: 29093061
  4. In adoptive therapy of disseminated leukemia, CD200R-CD28-transduced leukemia-specific CD8 T cells eradicated otherwise lethal disease more efficiently than wild-type cells and bypassed the requirement for interleukin-2 administration to sustain in vivo activity. PMID: 29042364
  5. Mutation of the basic clusters in the CD28 cytoplasmic domain reduced the recruitment to the CD28-Lck complex of protein kinase Ctheta; (PKCtheta;), which serves as a key effector kinase in the CD28 signaling pathway. PMID: 27460989
  6. Study shows that CD28 ligation during priming endows T cells with mitochondrial capacity that is important for future T cell responses. We speculate that CD28 temporarily restricts TXNIP and miR33 expression, and this leads to a transient induction of Cpt1a and fatty acid oxidation, which are marked by characteristic changes in mitochondria shape and structure. PMID: 28919076
  7. findings revealed a dual mechanism of monocyte and neutrophil recruitment by T cells relying on overlapping and nonoverlapping roles for the noninducible costimulatory receptor CD28 and the inflammatory cytokine TNF PMID: 27183621
  8. results are consistent with a complex pathway in which CD28 is the primary driver of Treg proliferation and CTLA-4 functions as the main brake but is also dependent on TCR signals and interactions with CD80/CD86. PMID: 28053234
  9. data suggest that mPEG PV1-Fab' acts mainly on IFN-gamma-producing CD4+ T cells and emphasize that this specific CD28 blockade strategy is a potential specific and alternative tool for the treatment of autoimmune disorders in the eye. PMID: 28248972
  10. the scaffolding role of RLTPR predominates during CD28 co-stimulation and underpins the similar function of RLTPR in human and mouse T cells. PMID: 27647348
  11. BAFF upregulates CD28/B7 and CD40/CD154 expression, and promotes the interactions between T and B cells in a BAFF-R-dependent manner PMID: 27180986
  12. Our data show that increasing the number and activation of Treg cells by a superagonistic antibody (CD28SA) is therapeutically effective in experimental arthritis. PMID: 26711629
  13. we report that cell-intrinsic deletion of CD28 after the peak of the primary response does not affect the establishment, maintenance, or recall of long-term memory. Thus, if given sufficient time, the progeny of primed CD8(+) T cells adapt to the absence of this costimulator. PMID: 27122236
  14. Deletion of CD28 co-stimulatory signals exacerbates left ventricular remodeling and increases cardiac rupture after MI through prolongation of the inflammatory period and reduction of collagen fiber in the infarct scars. PMID: 27396441
  15. identified a new plasmacytoid dendritic cells regulatory mechanism by which the same CD28 molecule that promotes stimulation in most cells PMID: 26773151
  16. Ndrg1 is phosphorylated and degraded by CD28 signalling in a proteasome-dependent manner. PMID: 26507712
  17. The CD4/CD8 positive lymphocyte count and the expression of CD28 and CD38 antigens in the murine schistosomiasis japonica model are reported. PMID: 26002824
  18. provide evidence that CD28 and the TCR complex regulate NF-kappaB via different signaling modules of GRB-2/VAV1 and LAT/ADAP pathways respectively. PMID: 25455592
  19. CD28 can still stimulate T cell activation in the absence of its cytosolic domain. PMID: 25725801
  20. CD3/CD28-inducible MNSFbeta-Bcl-G complex may be involved in the regulation of T cell function and survival. PMID: 25180634
  21. Virus exposure results in reduced T-cell expression of CD28. PMID: 25801976
  22. CD28 persistence is required for helper T cell polarization in response to infection. PMID: 25347065
  23. CD28 Vav motif in the B lineage was essential for the long-term maintenance of Ag-specific long-lived plasma cells populations PMID: 25833397
  24. host CD28 signaling controlled the pathogenesis of chronic graft-versus-host disease through effects on host Tregs, whose status impacts qualitatively on the allogeneic immune responses PMID: 25825447
  25. Data show that calcium-promoted Ras inactivator (CAPRI) C2AB domains are required for CD28 antigen inhibition of adhesion. PMID: 25637021
  26. Data suggest that attenuation of CD28 signaling is a promising therapeutic approach for mitigation of radiation-induced tissue injury. PMID: 25054224
  27. CD28 was found to participate in the process of embryo implantation. PMID: 24336670
  28. CD28-CD80 interactions control regulatory T cell motility and immunological synapse formation. PMID: 25355918
  29. CD28 costimulation is essential for conferring host protection during secondary N. brasiliensis infection. PMID: 24516382
  30. CD28 signaling uses tyrosine phosphorylation-dependent and phosphorylation-independent pathways. PMID: 24048955
  31. the critical CD28/B7 interactions, required to generate Th2 cells, may directly occur between CD4 T cells engaged with the same B cell acting as an APC. PMID: 24752446
  32. blockade of CD28 signals in the presence of preserved CTLA-4 signals results in the unique up-regulation of 2B4 on primary CD8(+) effectors, and that this 2B4 expression plays a critical functional role in controlling antigen-specific T8 cell responses PMID: 24493803
  33. Here, we targeted CD28 with siRNA to determine the role of the signaling pathway in the preservation of ultraviolet B induced skin alterations. PMID: 24042341
  34. Concurrent ablation of the CD28-activated Tec family kinase ITK does not block spontaneous T cell activation but instead causes self-reactive Ctla4(-/-) T cells to accumulate in secondary lymphoid organs. PMID: 24270545
  35. CD28 controls NKT-cell homeostasis and the size of the innate-like CD8(+) T-cell pool. PMID: 23896981
  36. Data indicate that CD28 is dispensable for gammadelta effector T cell development and differentiation. PMID: 23671671
  37. early Ag-independent encounters are an important window for optimizing T cell responses to Ag by CD28 PMID: 23966623
  38. B7-CD28 costimulatory pathways and IFN-gamma production have distinct and potentially opposing effects on T cells in the development of autoimmune peripheral neuropathy. PMID: 23487421
  39. created Treg-specific Cd28 conditional knockouts. Despite normal numbers of FOXP3+ cells, these animals accumulated large numbers of activated T cells, developed severe autoimmunity, and failed to resolve induced experimental allergic encephalomyelitis. PMID: 23281398
  40. controls Treg-cell homeostasis and function PMID: 23065717
  41. The effects of CD28 on alternative splicing provide a newly appreciated means by which CD28 can regulate T cell responses. PMID: 22768209
  42. Lack of CD28 expression on short-lived splenic plasma cells leads to increased antibody levels and might confer survival advantage. PMID: 22908331
  43. Direct CD28 costimulation of CD8-positive T-lymphocytes is critial in their priming during primary influenza infection. PMID: 22585421
  44. Results indicate AP-1 transcription factors are involved in ICOS gene expression downstream of both TCR/CD28 signaling and cytokine receptor signaling. PMID: 22585681
  45. ligation increases macrophage suppression of T-cell proliferation PMID: 22522653
  46. B7 costimulatory antigen and CD28 interactions promote proliferation and survival of activated murine gammadelta T cells following Plasmodium infection. PMID: 22732586
  47. Mice were protected from lethal superantigen challenge by short peptide mimetics of the CD28 dimer interface and by peptides selected to compete with the superantigen for its binding site in CD28. PMID: 21931534
  48. These results suggest that TCR-initiated inside-out signaling may induce a conformational change to the extracellular domains of CD28, enabling ligand binding and initiating CD28 signaling. PMID: 22068237
  49. Data show several homologies across human, rat and mouse in the kinetic of loss of several LAgs such as CD5, CD4 and CD28. PMID: 21745657
  50. CD28 and ICOS are synergistic in promoting graft vs. host disease after bone marrow transplantation. PMID: 21447398

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1