Recombinant Mycoplasma penetrans Lipoprotein signal peptidase(lspA)

Code CSB-CF816470MLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8EWS0
Storage Buffer Tris-based buffer,50% glycerol
Species Mycoplasma penetrans (strain HF-2)
Sequence MIKQFFSNVYEGIKHYSNYLWELSKKQLIKIYLNKKHLIWKISIILICAFIVLLTSFLTR NSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDT FVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEPIKKPIVIQKS
Source in vitro E.coli expression system
Gene Names lspA
Protein Names Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Expression Region 1-240
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase A8 family
Database Links

KEGG: mpe:MYPE1320

STRING: 272633.MYPE1320

Related Products

lspA Proteins

lspA Proteins for Mycoplasma penetrans (strain HF-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.