Recombinant Human Brain-derived neurotrophic factor(BDNF) (Active)

In Stock
Code CSB-AP003781HU
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P23560
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2
Alias Brain-Derived Neurotrophic Factor; BDNF; Abrineurin
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human TrkB in functional ELISA is less than 5 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Research Area Neuroscience
Source E.coli
Gene Names BDNF
Expression Region 129-247aa
Tag Info Tag-Free
Mol. Weight 13 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
Involvement in disease Bulimia nervosa 2 (BULN2); Congenital central hypoventilation syndrome (CCHS)
Subcellular Location Secreted
Protein Families NGF-beta family
Tissue Specificity Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
Database Links

HGNC: 1033

OMIM: 113505

KEGG: hsa:627

STRING: 9606.ENSP00000414303

UniGene: Hs.502182

Pathway cAMP signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Ras signaling pathway
Inflammatory Pain
Neurotrophin signaling pathway

Related Products

BDNF Antibodies

BDNF Antibodies for Homo sapiens (Human)

BDNF Antibodies for Human

BDNF Proteins

BDNF Proteins for Homo sapiens (Human)

BDNF ELISA Kit

BDNF ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.