Recombinant Human Brain-derived neurotrophic factor(BDNF) (Active)

In Stock
Code CSB-AP003781HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human TrkB in functional ELISA is less than 5 ug/ml.
Target Names BDNF
Uniprot No. P23560
Research Area Neuroscience
Alternative Names Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin
Species Homo sapiens (Human)
Source E.coli
Expression Region 129-247aa
Complete Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Mol. Weight 13 kDa
Protein Length Full Length of Mature Protein
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
Gene References into Functions
  1. The sample consisted of 181 suicide cases (47 early suicide cases, 134 late suicide cases) and 162 controls. Patients with the BDNF Met allele had a 1.42-fold increased risk of suicide when compared with the Val allele carrier. When a suicide case is stratified by occurrence time, patients with the Met/Val or Met/Met genotype had a 2.48-fold increased risk of committing suicide early than those with the Val/Val genotype. PMID: 29734216
  2. Low brain derived neurotrophic factor may contribute to the pathogenesis of schizophrenia, but maybe not to its cognitive impairments. PMID: 29482040
  3. In a 12-year longitudinal population-based sample of older adults (n = 2,218), we used growth curve modeling to investigate whether the benefits of physical activity on cognitive preservation differed by BDNF genotype and sex across multiple cognitive domains including processing speed, attention, working memory, and episodic verbal memory. PMID: 29402782
  4. Mn-SOD V allele carries a worse outcome profile after stroke, relating to nitrosative stress, inflammatory, and apoptotic response and associated with a BDNF reduction. PMID: 30150066
  5. while the BDNF Val66Met Megroup displayed significant SICI reduction in the bilateral M1 in response to motor training, short-interval intracortical inhibition (SICI) remained unchanged in the BDNF Val66Met group. PMID: 29856758
  6. Our study provides evidence for the correlation between the BDNF variant rs6265 and emotional symptoms in the early phase after mild traumatic brain injury. PMID: 29357818
  7. These results indicate that genetic variant Met66 decreased the serum BDNF levels in combination with self-reported risk-taking propensity among heroin users. PMID: 30134233
  8. serum BDNF levels and the BDNF Val66Met polymorphism in healthy young adults were associated with the sleep pattern on weekends but not with that on weekdays, suggesting that the systems involved in BDNF control may be linked to endogenous sleep characteristics rather than the socially constrained sleep schedule in healthy young adults. PMID: 29944703
  9. Neurotrophic factors and hippocampal activity in PTSD PMID: 29799860
  10. upregulation of PAI-1 may be a critical mechanism underlying insufficient neurotrophic support and increased neurodegeneration associated with AD. Thus, targeting BDNF maturation through pharmacological inhibition of PAI-1 might become a potential treatment for AD. PMID: 28132883
  11. This study shows the genetic correlates of early trauma in a group of schizophrenia patients (BDNF Met carriers). PMID: 28711474
  12. This study demonstrated significant differences in the blood levels of BDNF between people with epilepsy and healthy subjects. PMID: 30140987
  13. Study shows that brain-derived neurotrophic factor concentrations in serum and peritoneal fluid were significantly higher in women with endometriosis with pain compared to women with endometriosis without pain. PMID: 28954602
  14. Met allele of the Val66Met polymorphism in brain derived neurotrophic factor is associated with lower BMI-SDS in children PMID: 28960774
  15. platelet BDNF and SERT do not specifically underlie psychosocial deficits in stage Huntington's Disease, while higher BDNF storage in delayed mild symptoms PMID: 30039833
  16. Direct within family analysis showed that fathers with the Met allele were more likely than Val/Val carriers to exhibit differential parenting toward twins who differed in their prosocial behavior. The same pattern of findings was found with mother-rated and experimentally assessed prosociality. PMID: 28523227
  17. The results of this study suggest that the Val66Met polymorphism does not predict long-term, functional mobility following stroke. PMID: 29480080
  18. polymorphisms in BDNF gene including rs925946, rs10501087, rs6265 and rs988712 can be considered as genetic determinants of obesity (systematic review and meta-analysis). PMID: 28818748
  19. Single nucleotide polymorphism found in the BDNF-AS (BDNF antisense RNA [nonprotein coding]) gene may be related to the decreased plasma brain derived neurotrophic factor levels found in frail elderly people. PMID: 27449141
  20. The pattern of low BDNF and high inflammation in MDD may be influenced by the Val66Met polymorphism; the association of a polymorphism in the BDNF gene with inflammatory markers in addition to BDNF levels suggests an interaction between these systems. PMID: 28656803
  21. Angiogenin contributes to angiogenesis induced by Brain-derived neurotrophic factor (BDNF). PMID: 29573867
  22. Findings demonstrated that polymorphism Val66Met is not associated with temporal lobe epilepsy caused by hippocampal sclerosis, epilepsy-related factors and psychiatric comorbidities in this selected group of patients. PMID: 30015148
  23. Study suggested that BDNF 196 G>A polymorphism may be a genetic marker for predicting insulin resistance before initiating risperidone treatment in autism spectrum disorder patients. PMID: 29369497
  24. No significant difference was found in the BDNF Val66Met polymorphism between patients with GAD and healthy controls, nor was this polymorphism significantly associated with antidepressant drug efficacy for GAD PMID: 29446659
  25. Its single-nucleotide polymorphisms involves in dopaminergic metabolism and motor and cognitive function in older adults. PMID: 29525179
  26. BDNF rs11030101 and BDNF rs61888800are associated with change of temperament scores in a clinical sample of subjects with major depression (MDD), who received selective serotonin reuptake inhibitor treatment. PMID: 29310728
  27. We found that harsh parenting predicted an increased error-related negativity only among children with a methionine allele of the BDNF genotype, and evidence of moderated mediation: the ERN mediated the relationship between parenting and internalizing diagnoses and dimensional symptoms only if children had a methionine allele. PMID: 28427482
  28. Findings presented here suggest a strong influence of seasonality on depression outcome and BDNF expression in atopic dermatitis and psoriasis PMID: 27409526
  29. Serum BDNF was significantly lower in patients with Parkinson's disease than in patients with essential tremor and controls. PMID: 29350074
  30. The purpose of this systematic review was to provide a comprehensive analysis of the available clinical trials analyzing, in seniors, the effect of interval aerobic training (IAT) and continuous aerobic training (CAT) on peripheral brain-derived neurotrophic factor (BDNF) concentration. PMID: 28498065
  31. findings suggested that BDNF modulates graunlosa cell functions and the action probably mediated by FSHR-coupled signaling pathway, to affect aromatase-mediated steroidogenesis. PMID: 28282971
  32. The functional Val66Met BDNF polymorphism is not associated with BDNF serum levels in acute episode of schizophrenia and depression. PMID: 29331787
  33. This study demonstrated that a significantly higher incidence of defective BDNF expression in granule layers of the cerebellar cortex. PMID: 29174061
  34. combining cognitive and physical exercise had no additional or synergistic effect on peripheral BDNF levels compared with physical exercise alone PMID: 29842831
  35. Review/Meta-analysis: suggests a lower risk of ischemic stroke for the GG genotype of BDNF rs6265. PMID: 29449128
  36. that the BDNF SNP rs1157659 interacted with mild traumatic brain injury to predict hippocampal volume PMID: 28755387
  37. found that though there was no significantly difference in peripheral BDNF levels between ADHD patients and control groups overall, BDNF levels were significantly higher in males with ADHD compared with controls. PMID: 29132072
  38. found evidence that supported the hypothesis that BDNF Val66Met polymorphism moderated the relationship between stress and depression. PMID: 29102837
  39. the BDNF Val66Met polymorphism is associated with functional tuning of behaviorally-relevant frontolimbic circuitry, particularly involving the ventromedial prefrontal cortex, during higher-order learning. PMID: 28867340
  40. MicroRNA-103 suppresses glioma cell proliferation and invasion by targeting BDNF. PMID: 29257320
  41. High expression levels of BDNF was observed in cervical cancer.BDNF role in epithelial-mesenchymal transition, migration and invasion of cervical cancer. PMID: 29345295
  42. There was a statistically significant change in BDNF levels post-chemotherapy in early-stage breast cancer patients, and plasma BDNF levels were associated with self-perceived concentration deficit in patients receiving chemotherapy. PMID: 29258453
  43. Meta-analysis/Review: patients with ischemic stroke at high risk of post stroke depression have lower BDNF levels at the early stage of stroke. PMID: 29128330
  44. Coronary artery disease patients exhibited significantly lower plasma BDNF and higher vWF levels than those of control patients. PMID: 29409455
  45. Brain-derived neurotrophic factor (BDNF) was found to be the downstream target of miR-107 in breast cancer. PMID: 27813254
  46. This study showed that in first-episode psychosis subjects, with global DNA hypo-methylation and reduced BDNF gene-expression. PMID: 29056292
  47. down-regulated in cord blood by prenatal smoking PMID: 28130959
  48. BDNF/TrkB axis plays a role in epithelial mesenchymal transition promoting the acquisition of (myo)fibroblast cell phenotype in idiopathic pulmonary fibrosis. PMID: 28938915
  49. Results show that Lnc RNA BDNF-AS inversely regulates the expression level of BDNF which modulates high-glucose induced apoptosis in human retinal pigment epithelial cells. PMID: 28657668
  50. This study show a linear relationship between the BDNF Val66Met genotypes and plasma BDNF levels in Caucasian depressed patients. PMID: 28848102
  51. Low BDNF expression is associated with Parkinson's disease. PMID: 28923922
  52. Results suggest that serum brain-derived neurotrophic factor could play a role in modulating the cortical activity in response to visuo-tactile integration processes related to body image alteration in humans. PMID: 28668502
  53. In a study of the genetic association between polymorphisms in the DAT1, SERT, COMT and BDNF genes and attention deficit and hyperactive disorder, transmission disequilibrium test analysis showed that no individual allele of any variant studied has a preferential transmission PMID: 29122229
  54. This review focus is on crosstalk among BDNF, Glucocorticoids (GCs), and neurogenesis. It discusses recent studies concerning functional interaction between BDNF and GCs in altered neurogenesis, and show an interesting effect of GCs: Alteration in intracellular transport of BDNF protein under GCs stress. [review] PMID: 29099059
  55. Met homozygotes participants showed significantly less muscle-specific corticospinal sensitivity during action observation, as well as reduced visuomotor associative learning, compared to Val homozygotes. PMID: 27703276
  56. The results of the study may help to inform future health interventions that utilize physical activity as a means to improve cognitive development in children, adolescents, and adults. Additionally, the study may assist in determining whether the putative effects occur via modification of plasma IGF-1 or BDNF concentrations. PMID: 29094050
  57. MicroRNA-382 inhibits cell proliferation and invasion of retinoblastoma by targeting BDNF-mediated PI3K/AKT signaling pathway. PMID: 28901408
  58. No relation between the Val/Met polymorphism of the BDNF and the dynamics of the seizure threshold of electroconvulsive therapy in MDD. PMID: 27787610
  59. BDNF Val66Met polymorphism did not affect serum mBDNF, EM, or HV at baseline. While allelic variation in BDNF Val66Met may influence Abeta+ related neurodegeneration and memory loss over the short term, this is not related to serum mBDNF. PMID: 28720165
  60. Neither BDNF single markers nor haplotypes were found to be associated with suicide risk in treatment-resistant major depressive disorder patients. In gender-specific analyses, a nonsignificant trend towards single-marker association between rs908867 SNP and suicide risk in males was observed after correction for multiple testing. PMID: 28977521
  61. Walking speed decline in older adults is associated with elevated pro-BDNF in plasma extracellular vesicles. PMID: 28843509
  62. The microRNA miR-211/BDNF axis regulates LPS-induced normal human astrocytes proliferation through PI3K/AKT pathway . PMID: 28790168
  63. Redox dysregulation and alterations in the immuno-inflammatory pathways are major culprits in the pathogenesis of schizophrenia (SZ). MMP-9 and BDNF SNPs are associated with the clinical phenotype of SZ and, thus, may be a useful marker predicting the phenotypic expression and prognosis of SZ patients. PMID: 28100419
  64. BDNFVal66Met genotype as a regulator of behavioral despair. PMID: 28926000
  65. There is no association between the BDNF gene Val66Met (rs6265) and suicide behavior in the overall population; however, the BDNF Val66Met might increase the risk for suicide behavior in Asian and Caucasian populations. PMID: 28756290
  66. Brain-derived neurotrophic factor levels were significantly lower in 13 suicidal major depressive disorder patients than in 58 nonsuicidal major depressive disorder patients. PMID: 27811136
  67. The results of the present study do not support our hypothesis that BDNF plays a role in the early phase of language recovery after stroke. PMID: 28818006
  68. We demonstrated that the association between loneliness and white matter microstructure across widespread white matter fibers could be modulated by the BDNF Val66Met polymorphism, and the Val/Met heterozygotes might be more susceptible to perceived social isolation compared to the homozygotes. PMID: 28988974
  69. miR744, which is downregulated in gastric cancer tissues and cell lines, significantly correlates with lymph node metastasis, invasive depth and TNM staging in gastric cancer patients. Furthermore, miR744 overexpression suppresses the proliferation and invasion of gastric cancer cells by directly targeting BDNF. PMID: 28791400
  70. brain-derived neurotrophic factor (BDNF) and neurotrophin 3 (NT3) levels in post-mortem brain tissue from patients with depression compared to healthy individuals - a proof of concept study PMID: 29102768
  71. Low serum BDNF levels are associated with characteristics related to alcohol consumption and mood disorders, and variants of the BDNF gene in alcohol use disorder patients. PMID: 28485899
  72. The BDNF Val66Met polymorphism influences brain plasticity of children as shown by transcranial magnetic stimulation protocol, paired afferent stimulation. PMID: 27839823
  73. Significantly higher ratio of mBDNF to proBDNF (M/P) at baseline was showed in major depressive disorder group than those in bipolar disorder group as well as in healthy controls PMID: 27613282
  74. BDNF levels are higher in autism spectrum disorder compared with controls [review and meta-analysis] PMID: 27506602
  75. Study results demonstrated that high intensity exercise provides limited additional benefit to learning of a novel locomotor pattern in neurologically intact adults, despite increases in circulating brain derived neurotrophic factor (BDNF). In addition, presence of a single nucleotide polymorphism on the BDNF gene did not moderate the magnitude of serum BDNF increases with high intensity exercise. PMID: 28668279
  76. serum BDNF levels decreased with the increase in emotional abuse in self-harming adolescents PMID: 29017139
  77. Ginkgo biloba extract increased exercise-induced production of BDNF. PMID: 28933745
  78. Study indicates that antisense RNA of brain-derived neurotrophic factor (BDNF-AS) siRNA induces activation of the BDNF-TrkB-PI3K/Akt pathway following hypoxia/reoxygenation (H/R)-induced neurotoxicity. These findings will be useful toward the application of BDNF-AS siRNA for the treatment of neurodegenerative diseases. PMID: 28777258
  79. Mixed models repeated measurement was used to examine the therapeutic effect and changes in BDNF and cytokine levels between the groups PMID: 27270858
  80. urinary BDNF level test could evaluate the severity of lower urinary tract symptoms in benign prostatic hyperplasia patients. PMID: 28786061
  81. High school Chinese Han students with different genotypes of BDNF Val66Met polymorphism and gender had different prevalence of depression, different severity of depression, different potential factors of depression and independent predictors of depression at different times after the 2008 Wenchuan earthquake, suggesting interactions after stresses among BDNF Val66Met polymorphism, gender and time course on depression. PMID: 28527683
  82. Suggest that irisin exerts beneficial effect on mood in COPD patients, possibly by inducing the expression of BDNF in brain areas associated with reward-related processes involved in by depression. PMID: 28744117
  83. BDNF expression is up-regulated in NSCLC samples. BDNF stimulation increases the synthesis of BDNF itself through activation of STAT3 in lung cancer cells. PMID: 27456333
  84. These findings provides evidence that gene-gene interactions between p11, tPA and BDNF are all associated with post stroke depression. PMID: 29028593
  85. Study showed that proBDNF (PDNF precursor) and its predominant receptor, p75 pan-neurotrophin receptor were upregulated in the nerve fibers and inflammatory cells in the local tissue in inflammatory pain and that peripheral proBDNF is a potential pain mediator. PMID: 27251195
  86. The findings of this study suggest that decreased serum BDNF may be involved in the pathophysiology of depression in PD patients. PMID: 28576603
  87. rs10767664 polymorphism of BDNF gene is associated with prevalence of diabetes mellitus in obese female patients. PMID: 28595187
  88. It is unlikely that the investigated genetic variants are clinically relevantly associated with depression after diagnosis of cancer. PMID: 28590587
  89. BDNF promoted tumor lymphangiogenesis by downregulating miR-624-3p in human chondrosarcoma tissues. PMID: 28771226
  90. Results demonstrate that maternal experiences of war trauma and chronic stress were associated with BDNF methylation in umbilical cord blood, placental tissue, and maternal venous blood. Associations of maternal stress and BDNF methylation showed high tissue specificity. The majority of significant associations were observed in putative transcription factor binding regions. PMID: 28680507
  91. BDNF was associated with osteoporotic fracture risk. PMID: 27465306
  92. Homozygotes AA at rs6265 (BDNF), TT at rs16917234 (BDNF), and CC at rs508448 (OPRD1) also appeared as risk factors for the endophenotype earlier age of onset for heroin use. PMID: 28692418
  93. This study demonstrates that tactile cognition is influenced by genetic variations in the BDNF gene and is closely correlated with intrinsic brain activity by using a neuropsychological assessment tool to evaluate tactile cognitive capacity without the involvement of visual or auditory sensation. PMID: 28495599
  94. BDNF mRNA expression and DNA methylation of seven CpG sites were not associated with schizophrenia after accounting for age and PMI effects. BDNF mRNA expression and DNA methylation were not altered by Val66Met after accounting for age and PMI effects. Schizophrenia risk was not associated with differential BDNF mRNA expression and DNA methylation. PMID: 27712141
  95. antisense BDNF is lowly expressed in retinoblastoma, and may be used as a prognostic biomarker in RB. Upregulating BDNF-AS has inhibitory effect on RB development, probably through the suppression of cell-cycle transition PMID: 28131827
  96. BDNF Val66Met is a determinant of motor skill learning after stroke. PMID: 28751226
  97. Findings suggested an involvement of BDNF Val66Met polymorphism after childhood trauma in terms of risk for schizophrenia symptoms. PMID: 29595641
  98. Low plasma BDNF level is associated with hyperglycemia. PMID: 28328533
  99. There was no evidence to support that BDNF Val66Met or childhood adversity alone predicted treatment response to physical exercise and internet-based cognitive behavioural therapy. PMID: 28578208
  100. SNPs of the BDNF gene affect memory encoding during spatial navigation. PMID: 27717213

Show More

Hide All

Involvement in disease Bulimia nervosa 2 (BULN2); Congenital central hypoventilation syndrome (CCHS)
Subcellular Location Secreted
Protein Families NGF-beta family
Tissue Specificity Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
Database Links

HGNC: 1033

OMIM: 113505

KEGG: hsa:627

STRING: 9606.ENSP00000414303

UniGene: Hs.502182

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1