Purity
            Greater than 95% as determined by SDS-PAGE.
           
                              
            Endotoxin
            Less than 0.01 EU/µg as determined by LAL method.
           
                              
            Activity
            Measured by its binding ability in a functional ELISA. Immobilized Human TrkB (C-6His) at 5 μg/mL can bind Human BDNF, Biotinylated by NHS-biotin prior to testing, the EC50 of Human BDNF is ≤20 ng/mL.
           
                              
                                                  
                                        
            Research Area
            Neuroscience
           
                              
            Alternative Names
            
              Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin
             
           
                                        
            Species
            Homo sapiens (Human)
           
                              
                              
            Expression Region
            129-247aa
           
                              
            Complete Sequence            
            HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR            
           
                              
                              
            Protein Length
            Full Length of Mature Protein
           
                                        
                              
            Form
            
                            Liquid or Lyophilized powder                                        
           
                    
            Buffer
                          Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2                          
           
                                                  
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
             Basically, we can dispatch the products
              out in 1-3
              working days after receiving your orders. Delivery time may differ from different purchasing way or
              location, please kindly consult your local distributors for specific delivery time.
              Note: All of our proteins are default shipped with
                normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
                and extra fees will be charged.            
           
                    
            Datasheet & COA
             Please contact us to get it.