Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP002655HU |
| Size | $1812 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The process of expressing the recombinant human BDNF protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 129-247aa of the human BDNF protein and N-terminal 6xHis-SUMO tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 6xHis-SUMO-tagged recombinant BDNF protein was obtained. This recombinant BDNF protein is characterized by high purity (>90%, SDS-PAGE). This BDNF protein ran along the gel to the band of approximately 30 kDa molecular weight. BDNF is a gene providing instruction of making a protein named brain-derived neurotrophic factor (also abbreviated as BDNF) in human and belongs to NGF-beta family. BDNF has a wide array of functions within the brain, involving supporting differentiation, maturation, and survival of neurons in the nervous system. It is highly abundant in the CNS, gut and other tissues. The levels of BDNF are decreased in many neurodegenerative diseases such as Parkinson's disease (PD), multiple sclerosis (MS) and Huntington's disease. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | BDNF |
| Uniprot No. | P23560 |
| Research Area | Neuroscience |
| Alternative Names |
Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin
|
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 129-247aa |
| Target Protein Sequence | HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 29.5kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Important signaling molecule that activates signaling cascades downstream of NTRK2. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.; Important signaling molecule that activates signaling cascades downstream of NTRK2. Activates signaling cascades via the heterodimeric receptor formed by NGFR and SORCS2. Signaling via NGFR and SORCS2 plays a role in synaptic plasticity and long-term depression (LTD). Binding to NGFR and SORCS2 promotes neuronal apoptosis. Promotes neuronal growth cone collapse.
|
| Gene References into Functions |
|
| Involvement in disease | Bulimia nervosa 2 (BULN2); Congenital central hypoventilation syndrome (CCHS) |
| Subcellular Location | Secreted.; [BDNF precursor form]: Secreted. |
| Protein Families | NGF-beta family |
| Tissue Specificity | Detected in blood plasma and in saliva (at protein level). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. |
| Database Links |
HGNC: 1033 OMIM: 113505 KEGG: hsa:627 STRING: 9606.ENSP00000414303 UniGene: Hs.502182 |
