Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin
Species
Homo sapiens (Human)
Expression Region
129-247aa
Target Protein Sequence
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The process of expressing the recombinant human BDNF protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 129-247aa of the human BDNF protein and N-terminal 6xHis-SUMO tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 6xHis-SUMO-tagged recombinant BDNF protein was obtained. This recombinant BDNF protein is characterized by high purity (>90%, SDS-PAGE). This BDNF protein ran along the gel to the band of approximately 30 kDa molecular weight.
BDNF is a gene providing instruction of making a protein named brain-derived neurotrophic factor (also abbreviated as BDNF) in human and belongs to NGF-beta family. BDNF has a wide array of functions within the brain, involving supporting differentiation, maturation, and survival of neurons in the nervous system. It is highly abundant in the CNS, gut and other tissues. The levels of BDNF are decreased in many neurodegenerative diseases such as Parkinson's disease (PD), multiple sclerosis (MS) and Huntington's disease.
